Anti PDE7B pAb (ATL-HPA023967)

Atlas Antibodies

Catalog No.:
ATL-HPA023967-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: phosphodiesterase 7B
Gene Name: PDE7B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019990: 93%, ENSRNOG00000013436: 92%
Entrez Gene ID: 27115
Uniprot ID: Q9NP56
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QDRHFMLQIALKCADICNPCRIWEMSKQWSERVCEEFYRQGELEQKFELEISPLCNQQKDSIPSIQIGFMSYIVEPLFREWAHFTGNSTLSENMLGHLAHNKAQWKSLLPRQHRSRGSS
Gene Sequence QDRHFMLQIALKCADICNPCRIWEMSKQWSERVCEEFYRQGELEQKFELEISPLCNQQKDSIPSIQIGFMSYIVEPLFREWAHFTGNSTLSENMLGHLAHNKAQWKSLLPRQHRSRGSS
Gene ID - Mouse ENSMUSG00000019990
Gene ID - Rat ENSRNOG00000013436
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PDE7B pAb (ATL-HPA023967)
Datasheet Anti PDE7B pAb (ATL-HPA023967) Datasheet (External Link)
Vendor Page Anti PDE7B pAb (ATL-HPA023967) at Atlas Antibodies

Documents & Links for Anti PDE7B pAb (ATL-HPA023967)
Datasheet Anti PDE7B pAb (ATL-HPA023967) Datasheet (External Link)
Vendor Page Anti PDE7B pAb (ATL-HPA023967)