Anti PDE6B pAb (ATL-HPA059929)

Atlas Antibodies

Catalog No.:
ATL-HPA059929-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: phosphodiesterase 6B, cGMP-specific, rod, beta
Gene Name: PDE6B
Alternative Gene Name: CSNB3, CSNBAD2, PDEB, rd1, RP40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029491: 81%, ENSRNOG00000000065: 79%
Entrez Gene ID: 5158
Uniprot ID: P35913
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSLSEEQARSFLDQNPDFARQYFGKKLSPENVAAACEDGCPPDCDSLRDLCQVEEST
Gene Sequence MSLSEEQARSFLDQNPDFARQYFGKKLSPENVAAACEDGCPPDCDSLRDLCQVEEST
Gene ID - Mouse ENSMUSG00000029491
Gene ID - Rat ENSRNOG00000000065
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PDE6B pAb (ATL-HPA059929)
Datasheet Anti PDE6B pAb (ATL-HPA059929) Datasheet (External Link)
Vendor Page Anti PDE6B pAb (ATL-HPA059929) at Atlas Antibodies

Documents & Links for Anti PDE6B pAb (ATL-HPA059929)
Datasheet Anti PDE6B pAb (ATL-HPA059929) Datasheet (External Link)
Vendor Page Anti PDE6B pAb (ATL-HPA059929)