Anti PDE6B pAb (ATL-HPA059929)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059929-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PDE6B
Alternative Gene Name: CSNB3, CSNBAD2, PDEB, rd1, RP40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029491: 81%, ENSRNOG00000000065: 79%
Entrez Gene ID: 5158
Uniprot ID: P35913
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MSLSEEQARSFLDQNPDFARQYFGKKLSPENVAAACEDGCPPDCDSLRDLCQVEEST |
| Gene Sequence | MSLSEEQARSFLDQNPDFARQYFGKKLSPENVAAACEDGCPPDCDSLRDLCQVEEST |
| Gene ID - Mouse | ENSMUSG00000029491 |
| Gene ID - Rat | ENSRNOG00000000065 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PDE6B pAb (ATL-HPA059929) | |
| Datasheet | Anti PDE6B pAb (ATL-HPA059929) Datasheet (External Link) |
| Vendor Page | Anti PDE6B pAb (ATL-HPA059929) at Atlas Antibodies |
| Documents & Links for Anti PDE6B pAb (ATL-HPA059929) | |
| Datasheet | Anti PDE6B pAb (ATL-HPA059929) Datasheet (External Link) |
| Vendor Page | Anti PDE6B pAb (ATL-HPA059929) |