Anti PDE6A pAb (ATL-HPA074677 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA074677-25

Protein Description: phosphodiesterase 6A
Gene Name: PDE6A
Alternative Gene Name: PDEA, RP43
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024575: 87%, ENSRNOG00000017816: 86%
Entrez Gene ID: 5145
Uniprot ID: P16499
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEVEKFLDSNIGFAKQYYNLHYRAKLISDLLGAKEAAVDFSNYHSPSSMEESEIIFDLLRDFQENLQTEKCIFNVM
• Gene Sequence: EEVEKFLDSNIGFAKQYYNLHYRAKLISDLLGAKEAAVDFSNYHSPSSMEESEIIFDLLRDFQENLQTEKCIFNVM
• Gene ID - Mouse: ENSMUSG00000024575
• Gene ID - Rat: ENSRNOG00000017816
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.