Anti PDE6A pAb (ATL-HPA074677 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA074677-25
  • Immunohistochemical staining of human cerebral cortex, endometrium, eye, retina and liver using Anti-PDE6A antibody HPA074677 (A) shows similar protein distribution across tissues to independent antibody HPA016970 (B).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: phosphodiesterase 6A
Gene Name: PDE6A
Alternative Gene Name: PDEA, RP43
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024575: 87%, ENSRNOG00000017816: 86%
Entrez Gene ID: 5145
Uniprot ID: P16499
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEVEKFLDSNIGFAKQYYNLHYRAKLISDLLGAKEAAVDFSNYHSPSSMEESEIIFDLLRDFQENLQTEKCIFNVM
Gene Sequence EEVEKFLDSNIGFAKQYYNLHYRAKLISDLLGAKEAAVDFSNYHSPSSMEESEIIFDLLRDFQENLQTEKCIFNVM
Gene ID - Mouse ENSMUSG00000024575
Gene ID - Rat ENSRNOG00000017816
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PDE6A pAb (ATL-HPA074677 w/enhanced validation)
Datasheet Anti PDE6A pAb (ATL-HPA074677 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PDE6A pAb (ATL-HPA074677 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PDE6A pAb (ATL-HPA074677 w/enhanced validation)
Datasheet Anti PDE6A pAb (ATL-HPA074677 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PDE6A pAb (ATL-HPA074677 w/enhanced validation)