Anti PDE4A pAb (ATL-HPA076091)

Atlas Antibodies

Catalog No.:
ATL-HPA076091-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: phosphodiesterase 4A, cAMP-specific
Gene Name: PDE4A
Alternative Gene Name: DPDE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032177: 92%, ENSRNOG00000020828: 94%
Entrez Gene ID: 5141
Uniprot ID: P27815
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LRSVRSNFSLLTNVPVPSNKRSPLGGPTPVCKATLSEETCQQLARETLEEL
Gene Sequence LRSVRSNFSLLTNVPVPSNKRSPLGGPTPVCKATLSEETCQQLARETLEEL
Gene ID - Mouse ENSMUSG00000032177
Gene ID - Rat ENSRNOG00000020828
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PDE4A pAb (ATL-HPA076091)
Datasheet Anti PDE4A pAb (ATL-HPA076091) Datasheet (External Link)
Vendor Page Anti PDE4A pAb (ATL-HPA076091) at Atlas Antibodies

Documents & Links for Anti PDE4A pAb (ATL-HPA076091)
Datasheet Anti PDE4A pAb (ATL-HPA076091) Datasheet (External Link)
Vendor Page Anti PDE4A pAb (ATL-HPA076091)