Anti PDE4A pAb (ATL-HPA076091)
Atlas Antibodies
- Catalog No.:
- ATL-HPA076091-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PDE4A
Alternative Gene Name: DPDE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032177: 92%, ENSRNOG00000020828: 94%
Entrez Gene ID: 5141
Uniprot ID: P27815
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LRSVRSNFSLLTNVPVPSNKRSPLGGPTPVCKATLSEETCQQLARETLEEL |
| Gene Sequence | LRSVRSNFSLLTNVPVPSNKRSPLGGPTPVCKATLSEETCQQLARETLEEL |
| Gene ID - Mouse | ENSMUSG00000032177 |
| Gene ID - Rat | ENSRNOG00000020828 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PDE4A pAb (ATL-HPA076091) | |
| Datasheet | Anti PDE4A pAb (ATL-HPA076091) Datasheet (External Link) |
| Vendor Page | Anti PDE4A pAb (ATL-HPA076091) at Atlas Antibodies |
| Documents & Links for Anti PDE4A pAb (ATL-HPA076091) | |
| Datasheet | Anti PDE4A pAb (ATL-HPA076091) Datasheet (External Link) |
| Vendor Page | Anti PDE4A pAb (ATL-HPA076091) |