Anti PDE1C pAb (ATL-HPA021751)

Atlas Antibodies

Catalog No.:
ATL-HPA021751-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: phosphodiesterase 1C, calmodulin-dependent 70kDa
Gene Name: PDE1C
Alternative Gene Name: Hcam3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004347: 94%, ENSRNOG00000012337: 97%
Entrez Gene ID: 5137
Uniprot ID: Q14123
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKRSGVKTSGSEGSAPINNSVISVDYKSFKATWTE
Gene Sequence QSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKRSGVKTSGSEGSAPINNSVISVDYKSFKATWTE
Gene ID - Mouse ENSMUSG00000004347
Gene ID - Rat ENSRNOG00000012337
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PDE1C pAb (ATL-HPA021751)
Datasheet Anti PDE1C pAb (ATL-HPA021751) Datasheet (External Link)
Vendor Page Anti PDE1C pAb (ATL-HPA021751) at Atlas Antibodies

Documents & Links for Anti PDE1C pAb (ATL-HPA021751)
Datasheet Anti PDE1C pAb (ATL-HPA021751) Datasheet (External Link)
Vendor Page Anti PDE1C pAb (ATL-HPA021751)