Anti PDE1A pAb (ATL-HPA022151 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA022151-100

Protein Description: phosphodiesterase 1A, calmodulin-dependent
Gene Name: PDE1A
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059173: 97%, ENSRNOG00000054212: 95%
Entrez Gene ID: 5136
Uniprot ID: P54750
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RNLVIEMVLSTDMSGHFQQIKNIRNSLQQPEGIDRAKTMSLILHAADISHPAKSWKLHYRWTMALMEEFFLQGDKEAE
• Gene Sequence: RNLVIEMVLSTDMSGHFQQIKNIRNSLQQPEGIDRAKTMSLILHAADISHPAKSWKLHYRWTMALMEEFFLQGDKEAE
• Gene ID - Mouse: ENSMUSG00000059173
• Gene ID - Rat: ENSRNOG00000054212
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.