Anti PDCL3 pAb (ATL-HPA027094)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027094-25
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/640x640/products/86206/157235/atl-hpa027094_anti-pdcl3-pab-atl-hpa027094_38868__02087.1681108126.jpg?c=2 "Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue")
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PDCL3
Alternative Gene Name: VIAF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026078: 86%, ENSRNOG00000013286: 85%
Entrez Gene ID: 79031
Uniprot ID: Q9H2J4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EWNDILRKKGILPPKESLKELEEEAEEEQRILQQSVVKTYEDMTLEELEDHEDEFNEEDERAIEMYRRRRLAEWKATKLK |
| Gene Sequence | EWNDILRKKGILPPKESLKELEEEAEEEQRILQQSVVKTYEDMTLEELEDHEDEFNEEDERAIEMYRRRRLAEWKATKLK |
| Gene ID - Mouse | ENSMUSG00000026078 |
| Gene ID - Rat | ENSRNOG00000013286 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PDCL3 pAb (ATL-HPA027094) | |
| Datasheet | Anti PDCL3 pAb (ATL-HPA027094) Datasheet (External Link) |
| Vendor Page | Anti PDCL3 pAb (ATL-HPA027094) at Atlas Antibodies |
| Documents & Links for Anti PDCL3 pAb (ATL-HPA027094) | |
| Datasheet | Anti PDCL3 pAb (ATL-HPA027094) Datasheet (External Link) |
| Vendor Page | Anti PDCL3 pAb (ATL-HPA027094) |
| Citations for Anti PDCL3 pAb (ATL-HPA027094) – 1 Found |
| Srinivasan, Srimathi; Chitalia, Vipul; Meyer, Rosana D; Hartsough, Edward; Mehta, Manisha; Harrold, Itrat; Anderson, Nicole; Feng, Hui; Smith, Lois E H; Jiang, Yan; Costello, Catherine E; Rahimi, Nader. Hypoxia-induced expression of phosducin-like 3 regulates expression of VEGFR-2 and promotes angiogenesis. Angiogenesis. 2015;18(4):449-62. PubMed |