Anti PDCD7 pAb (ATL-HPA049388)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049388-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PDCD7
Alternative Gene Name: ES18, HES18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041837: 96%, ENSRNOG00000014340: 94%
Entrez Gene ID: 10081
Uniprot ID: Q8N8D1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RWRVKCVQEVEEKKREQELKAAADGVLSEVRKKQADTKRMVDILRALEKLRKLRKEAAARKGVCPPASADETFTHHLQRL |
| Gene Sequence | RWRVKCVQEVEEKKREQELKAAADGVLSEVRKKQADTKRMVDILRALEKLRKLRKEAAARKGVCPPASADETFTHHLQRL |
| Gene ID - Mouse | ENSMUSG00000041837 |
| Gene ID - Rat | ENSRNOG00000014340 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PDCD7 pAb (ATL-HPA049388) | |
| Datasheet | Anti PDCD7 pAb (ATL-HPA049388) Datasheet (External Link) |
| Vendor Page | Anti PDCD7 pAb (ATL-HPA049388) at Atlas Antibodies |
| Documents & Links for Anti PDCD7 pAb (ATL-HPA049388) | |
| Datasheet | Anti PDCD7 pAb (ATL-HPA049388) Datasheet (External Link) |
| Vendor Page | Anti PDCD7 pAb (ATL-HPA049388) |