Anti PDCD7 pAb (ATL-HPA049388)

Atlas Antibodies

Catalog No.:
ATL-HPA049388-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: programmed cell death 7
Gene Name: PDCD7
Alternative Gene Name: ES18, HES18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041837: 96%, ENSRNOG00000014340: 94%
Entrez Gene ID: 10081
Uniprot ID: Q8N8D1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RWRVKCVQEVEEKKREQELKAAADGVLSEVRKKQADTKRMVDILRALEKLRKLRKEAAARKGVCPPASADETFTHHLQRL
Gene Sequence RWRVKCVQEVEEKKREQELKAAADGVLSEVRKKQADTKRMVDILRALEKLRKLRKEAAARKGVCPPASADETFTHHLQRL
Gene ID - Mouse ENSMUSG00000041837
Gene ID - Rat ENSRNOG00000014340
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PDCD7 pAb (ATL-HPA049388)
Datasheet Anti PDCD7 pAb (ATL-HPA049388) Datasheet (External Link)
Vendor Page Anti PDCD7 pAb (ATL-HPA049388) at Atlas Antibodies

Documents & Links for Anti PDCD7 pAb (ATL-HPA049388)
Datasheet Anti PDCD7 pAb (ATL-HPA049388) Datasheet (External Link)
Vendor Page Anti PDCD7 pAb (ATL-HPA049388)