Anti PDCD2L pAb (ATL-HPA052181)

Atlas Antibodies

Catalog No.:
ATL-HPA052181-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: programmed cell death 2-like
Gene Name: PDCD2L
Alternative Gene Name: MGC13096
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002635: 72%, ENSRNOG00000021119: 68%
Entrez Gene ID: 84306
Uniprot ID: Q9BRP1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FLPYYICVADEDDYRDFVNLDHAHSLLRDYQQREGIAMDQLLSQSLPNDGDEKYEKTIIKSGDQTFYKFMKRIAACQEQIL
Gene Sequence FLPYYICVADEDDYRDFVNLDHAHSLLRDYQQREGIAMDQLLSQSLPNDGDEKYEKTIIKSGDQTFYKFMKRIAACQEQIL
Gene ID - Mouse ENSMUSG00000002635
Gene ID - Rat ENSRNOG00000021119
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PDCD2L pAb (ATL-HPA052181)
Datasheet Anti PDCD2L pAb (ATL-HPA052181) Datasheet (External Link)
Vendor Page Anti PDCD2L pAb (ATL-HPA052181) at Atlas Antibodies

Documents & Links for Anti PDCD2L pAb (ATL-HPA052181)
Datasheet Anti PDCD2L pAb (ATL-HPA052181) Datasheet (External Link)
Vendor Page Anti PDCD2L pAb (ATL-HPA052181)