Anti PDCD2 pAb (ATL-HPA075534)

Atlas Antibodies

Catalog No.:
ATL-HPA075534-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: programmed cell death 2
Gene Name: PDCD2
Alternative Gene Name: RP8, ZMYND7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014771: 82%, ENSRNOG00000001490: 80%
Entrez Gene ID: 5134
Uniprot ID: Q16342
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLSFLLQVYAPLPGRPDAFHRCIFLFCCREQPCCAGLRVFRNQLPRKNDFYSYEPPSENPPPETGESVCLQLKSGA
Gene Sequence PLSFLLQVYAPLPGRPDAFHRCIFLFCCREQPCCAGLRVFRNQLPRKNDFYSYEPPSENPPPETGESVCLQLKSGA
Gene ID - Mouse ENSMUSG00000014771
Gene ID - Rat ENSRNOG00000001490
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PDCD2 pAb (ATL-HPA075534)
Datasheet Anti PDCD2 pAb (ATL-HPA075534) Datasheet (External Link)
Vendor Page Anti PDCD2 pAb (ATL-HPA075534) at Atlas Antibodies

Documents & Links for Anti PDCD2 pAb (ATL-HPA075534)
Datasheet Anti PDCD2 pAb (ATL-HPA075534) Datasheet (External Link)
Vendor Page Anti PDCD2 pAb (ATL-HPA075534)