Anti PDCD1LG2 pAb (ATL-HPA013411)

Atlas Antibodies

Catalog No.: ATL-HPA013411-25

Protein Description: programmed cell death 1 ligand 2
Gene Name: PDCD1LG2
Alternative Gene Name: B7-DC, bA574F11.2, Btdc, CD273, PD-L2, PDL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016498: 77%, ENSRNOG00000016136: 77%
Entrez Gene ID: 80380
Uniprot ID: Q9BQ51
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQSQMEPRTHPT
• Gene Sequence: GYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQSQMEPRTHPT
• Gene ID - Mouse: ENSMUSG00000016498
• Gene ID - Rat: ENSRNOG00000016136
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PDCD1LG2 pAb (ATL-HPA013411) – 4 Found

Zhang, Yang; Wang, Lei; Li, Yuan; Pan, Yunjian; Wang, Rui; Hu, Haichuan; Li, Hang; Luo, Xiaoyang; Ye, Ting; Sun, Yihua; Chen, Haiquan. Protein expression of programmed death 1 ligand 1 and ligand 2 independently predict poor prognosis in surgically resected lung adenocarcinoma. Oncotargets And Therapy. 7( 24748806):567-73. 

Solinas, Cinzia; Aiello, Marco; Rozali, Esdy; Lambertini, Matteo; Willard-Gallo, Karen; Migliori, Edoardo. Programmed cell death-ligand 2: A neglected but important target in the immune response to cancer?. Translational Oncology. 2020;13(10):100811. 

Dowell, Alexander C; Munford, Haydn; Goel, Anshita; Gordon, Naheema S; James, Nicholas D; Cheng, K K; Zeegers, Maurice P; Ward, Douglas G; Bryan, Richard T. PD-L2 Is Constitutively Expressed in Normal and Malignant Urothelium. Frontiers In Oncology. 11( 33718196):626748. 

Chervoneva, Inna; Peck, Amy R; Sun, Yunguang; Yi, Misung; Udhane, Sameer S; Langenheim, John F; Girondo, Melanie A; Jorns, Julie M; Chaudhary, Lubna N; Kamaraju, Sailaja; Bergom, Carmen; Flister, Michael J; Hooke, Jeffrey A; Kovatich, Albert J; Shriver, Craig D; Hu, Hai; Palazzo, Juan P; Bibbo, Marluce; Hyslop, Terry; Nevalainen, Marja T; Pestell, Richard G; Fuchs, Serge Y; Mitchell, Edith P; Rui, Hallgeir. High PD-L2 Predicts Early Recurrence of ER-Positive Breast Cancer. Jco Precision Oncology. 2023;7( 36652667):e2100498.