Anti PDCD11 pAb (ATL-HPA017924)

Atlas Antibodies

Catalog No.: ATL-HPA017924-25

Protein Description: programmed cell death 11
Gene Name: PDCD11
Alternative Gene Name: ALG-4, KIAA0185, RRP5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025047: 77%, ENSRNOG00000020304: 76%
Entrez Gene ID: 22984
Uniprot ID: Q14690
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LTGPHKLEEGEVAMGRVVKVTPNEGLTVSFPFGKIGTVSIFHMSDSYSETPLEDFVPQKVVRCYILSTADNVLTLSLRSSRTNPETKSKVEDPEINSIQDIKEGQLLRGYVGSIQPHG
• Gene Sequence: LTGPHKLEEGEVAMGRVVKVTPNEGLTVSFPFGKIGTVSIFHMSDSYSETPLEDFVPQKVVRCYILSTADNVLTLSLRSSRTNPETKSKVEDPEINSIQDIKEGQLLRGYVGSIQPHG
• Gene ID - Mouse: ENSMUSG00000025047
• Gene ID - Rat: ENSRNOG00000020304
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PDCD11 pAb (ATL-HPA017924) – 1 Found

Yang, Ruimeng; Zhan, Ming; Guo, Miaomiao; Yuan, Hao; Wang, Yiqin; Zhang, Yiyue; Zhang, Wenqing; Chen, Saijuan; de The, Hugues; Chen, Zhu; Zhou, Jun; Zhu, Jun. Yolk sac-derived Pdcd11-positive cells modulate zebrafish microglia differentiation through the NF-κB-Tgfβ1 pathway. Cell Death And Differentiation. 2021;28(1):170-183.