Anti PDCD10 pAb (ATL-HPA027095)

Atlas Antibodies

Catalog No.: ATL-HPA027095-25

Protein Description: programmed cell death 10
Gene Name: PDCD10
Alternative Gene Name: CCM3, TFAR15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027835: 100%, ENSRNOG00000010147: 92%
Entrez Gene ID: 11235
Uniprot ID: Q9BUL8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMK
• Gene Sequence: MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMK
• Gene ID - Mouse: ENSMUSG00000027835
• Gene ID - Rat: ENSRNOG00000010147
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PDCD10 pAb (ATL-HPA027095) – 1 Found

De Marco, Carmela; Zoppoli, Pietro; Rinaldo, Nicola; Morganella, Sandro; Morello, Matteo; Zuccalà, Valeria; Carriero, Maria Vincenza; Malanga, Donatella; Chirillo, Roberta; Bruni, Paola; Malzoni, Carmine; Di Vizio, Dolores; Venturella, Roberta; Zullo, Fulvio; Rizzuto, Antonia; Ceccarelli, Michele; Ciliberto, Gennaro; Viglietto, Giuseppe. Genome-wide analysis of copy number alterations led to the characterisation of PDCD10 as oncogene in ovarian cancer. Translational Oncology. 2021;14(3):101013.