Anti PDC pAb (ATL-HPA062235)

Atlas Antibodies

Catalog No.:
ATL-HPA062235-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: phosducin
Gene Name: PDC
Alternative Gene Name: MEKA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006007: 89%, ENSRNOG00000002517: 91%
Entrez Gene ID: 5132
Uniprot ID: P20941
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DWRKFKLESQDSDSIPPSKKEILRQMSSPQSRNGKDSKERVSRKMSIQEYELI
Gene Sequence DWRKFKLESQDSDSIPPSKKEILRQMSSPQSRNGKDSKERVSRKMSIQEYELI
Gene ID - Mouse ENSMUSG00000006007
Gene ID - Rat ENSRNOG00000002517
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PDC pAb (ATL-HPA062235)
Datasheet Anti PDC pAb (ATL-HPA062235) Datasheet (External Link)
Vendor Page Anti PDC pAb (ATL-HPA062235) at Atlas Antibodies

Documents & Links for Anti PDC pAb (ATL-HPA062235)
Datasheet Anti PDC pAb (ATL-HPA062235) Datasheet (External Link)
Vendor Page Anti PDC pAb (ATL-HPA062235)