Anti PDC pAb (ATL-HPA062235)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062235-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PDC
Alternative Gene Name: MEKA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006007: 89%, ENSRNOG00000002517: 91%
Entrez Gene ID: 5132
Uniprot ID: P20941
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DWRKFKLESQDSDSIPPSKKEILRQMSSPQSRNGKDSKERVSRKMSIQEYELI |
Gene Sequence | DWRKFKLESQDSDSIPPSKKEILRQMSSPQSRNGKDSKERVSRKMSIQEYELI |
Gene ID - Mouse | ENSMUSG00000006007 |
Gene ID - Rat | ENSRNOG00000002517 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PDC pAb (ATL-HPA062235) | |
Datasheet | Anti PDC pAb (ATL-HPA062235) Datasheet (External Link) |
Vendor Page | Anti PDC pAb (ATL-HPA062235) at Atlas Antibodies |
Documents & Links for Anti PDC pAb (ATL-HPA062235) | |
Datasheet | Anti PDC pAb (ATL-HPA062235) Datasheet (External Link) |
Vendor Page | Anti PDC pAb (ATL-HPA062235) |