Anti PCYT1B pAb (ATL-HPA006367)

Atlas Antibodies

Catalog No.:
ATL-HPA006367-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: phosphate cytidylyltransferase 1, choline, beta
Gene Name: PCYT1B
Alternative Gene Name: CCT-beta, CTB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035246: 95%, ENSRNOG00000012358: 96%
Entrez Gene ID: 9468
Uniprot ID: Q9Y5K3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PVVTTDAESETGIPKSLSNEPPSETMEEIEHTCPQPRLTLTAPAPFADETNCQCQAPHEKLTIAQARLGTPADRPVRVYADGIFDLFHSGHARALMQAKTLFPNSYLLVGV
Gene Sequence PVVTTDAESETGIPKSLSNEPPSETMEEIEHTCPQPRLTLTAPAPFADETNCQCQAPHEKLTIAQARLGTPADRPVRVYADGIFDLFHSGHARALMQAKTLFPNSYLLVGV
Gene ID - Mouse ENSMUSG00000035246
Gene ID - Rat ENSRNOG00000012358
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PCYT1B pAb (ATL-HPA006367)
Datasheet Anti PCYT1B pAb (ATL-HPA006367) Datasheet (External Link)
Vendor Page Anti PCYT1B pAb (ATL-HPA006367) at Atlas Antibodies

Documents & Links for Anti PCYT1B pAb (ATL-HPA006367)
Datasheet Anti PCYT1B pAb (ATL-HPA006367) Datasheet (External Link)
Vendor Page Anti PCYT1B pAb (ATL-HPA006367)