Anti PCTP pAb (ATL-HPA022979)
Atlas Antibodies
- Catalog No.:
- ATL-HPA022979-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PCTP
Alternative Gene Name: STARD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020553: 79%, ENSRNOG00000002425: 78%
Entrez Gene ID: 58488
Uniprot ID: Q9UKL6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LAAGSFSEEQFWEACAELQQPALAGADWQLLVETSGISIYRLLDKKTGLYEYKVFGVLEDCSPTLLAD |
| Gene Sequence | LAAGSFSEEQFWEACAELQQPALAGADWQLLVETSGISIYRLLDKKTGLYEYKVFGVLEDCSPTLLAD |
| Gene ID - Mouse | ENSMUSG00000020553 |
| Gene ID - Rat | ENSRNOG00000002425 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PCTP pAb (ATL-HPA022979) | |
| Datasheet | Anti PCTP pAb (ATL-HPA022979) Datasheet (External Link) |
| Vendor Page | Anti PCTP pAb (ATL-HPA022979) at Atlas Antibodies |
| Documents & Links for Anti PCTP pAb (ATL-HPA022979) | |
| Datasheet | Anti PCTP pAb (ATL-HPA022979) Datasheet (External Link) |
| Vendor Page | Anti PCTP pAb (ATL-HPA022979) |