Anti PCTP pAb (ATL-HPA022979)

Atlas Antibodies

Catalog No.:
ATL-HPA022979-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: phosphatidylcholine transfer protein
Gene Name: PCTP
Alternative Gene Name: STARD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020553: 79%, ENSRNOG00000002425: 78%
Entrez Gene ID: 58488
Uniprot ID: Q9UKL6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LAAGSFSEEQFWEACAELQQPALAGADWQLLVETSGISIYRLLDKKTGLYEYKVFGVLEDCSPTLLAD
Gene Sequence LAAGSFSEEQFWEACAELQQPALAGADWQLLVETSGISIYRLLDKKTGLYEYKVFGVLEDCSPTLLAD
Gene ID - Mouse ENSMUSG00000020553
Gene ID - Rat ENSRNOG00000002425
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PCTP pAb (ATL-HPA022979)
Datasheet Anti PCTP pAb (ATL-HPA022979) Datasheet (External Link)
Vendor Page Anti PCTP pAb (ATL-HPA022979) at Atlas Antibodies

Documents & Links for Anti PCTP pAb (ATL-HPA022979)
Datasheet Anti PCTP pAb (ATL-HPA022979) Datasheet (External Link)
Vendor Page Anti PCTP pAb (ATL-HPA022979)