Anti PCSK1 pAb (ATL-HPA079656)

Atlas Antibodies

SKU: ATL-HPA079656-25

• 

Protein Description: proprotein convertase subtilisin/kexin type 1
Gene Name: PCSK1
Alternative Gene Name: NEC1, PC1, PC3, SPC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021587: 80%, ENSRNOG00000011107: 82%
Entrez Gene ID: 5122
Uniprot ID: P29120
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EGRIVNWKLILHGTSSQPEHMKQPRVYTSYNTVQNDRRGVEKMVDPGEEQPTQENPKENTLVSKS
• Gene Sequence: EGRIVNWKLILHGTSSQPEHMKQPRVYTSYNTVQNDRRGVEKMVDPGEEQPTQENPKENTLVSKS
• Gene ID - Mouse: ENSMUSG00000021587
• Gene ID - Rat: ENSRNOG00000011107
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.