Anti PCP4 pAb (ATL-HPA005792 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA005792-25

Protein Description: Purkinje cell protein 4
Gene Name: PCP4
Alternative Gene Name: PEP-19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000159: 96%, ENSRNOG00000001628: 96%
Entrez Gene ID: 5121
Uniprot ID: P48539
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKK
• Gene Sequence: GAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKK
• Gene ID - Mouse: ENSMUSG00000000159
• Gene ID - Rat: ENSRNOG00000001628
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PCP4 pAb (ATL-HPA005792 w/enhanced validation) – 33 Found

Ray, Saikat; Brecht, Michael. Structural development and dorsoventral maturation of the medial entorhinal cortex. Elife. 2016;5( 27036175):e13343. 

Srinivas, Kalyan V; Buss, Eric W; Sun, Qian; Santoro, Bina; Takahashi, Hiroto; Nicholson, Daniel A; Siegelbaum, Steven A. The Dendrites of CA2 and CA1 Pyramidal Neurons Differentially Regulate Information Flow in the Cortico-Hippocampal Circuit. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2017;37(12):3276-3293. 

Fernández-Ruiz, Antonio; Oliva, Azahara; Nagy, Gergő A; Maurer, Andrew P; Berényi, Antal; Buzsáki, György. Entorhinal-CA3 Dual-Input Control of Spike Timing in the Hippocampus by Theta-Gamma Coupling. Neuron. 2017;93(5):1213-1226.e5. 

Ray, Saikat; Burgalossi, Andrea; Brecht, Michael; Naumann, Robert K. Complementary Modular Microcircuits of the Rat Medial Entorhinal Cortex. Frontiers In Systems Neuroscience. 11( 28443003):20. 

Leroy, Felix; Park, Jung; Asok, Arun; Brann, David H; Meira, Torcato; Boyle, Lara M; Buss, Eric W; Kandel, Eric R; Siegelbaum, Steven A. A circuit from hippocampal CA2 to lateral septum disinhibits social aggression. Nature. 2018;564(7735):213-218. 

Fernandez-Lamo, Ivan; Gomez-Dominguez, Daniel; Sanchez-Aguilera, Alberto; Oliva, Azahara; Morales, Aixa Victoria; Valero, Manuel; Cid, Elena; Berenyi, Antal; Menendez de la Prida, Liset. Proximodistal Organization of the CA2 Hippocampal Area. Cell Reports. 2019;26(7):1734-1746.e6. 

Ramaglia, Valeria; Dubey, Mohit; Malpede, M Alfonso; Petersen, Naomi; de Vries, Sharon I; Ahmed, Shanzeh M; Lee, Dennis S W; Schenk, Geert J; Gold, Stefan M; Huitinga, Inge; Gommerman, Jennifer L; Geurts, Jeroen J G; Kole, Maarten H P. Complement-associated loss of CA2 inhibitory synapses in the demyelinated hippocampus impairs memory. Acta Neuropathologica. 2021;142(4):643-667. 

Oakley, Robert H; Whirledge, Shannon D; Petrillo, Maria G; Riddick, Natallia V; Xu, Xiaojiang; Moy, Sheryl S; Cidlowski, John A. Combinatorial actions of glucocorticoid and mineralocorticoid stress hormone receptors are required for preventing neurodegeneration of the mouse hippocampus. Neurobiology Of Stress. 2021;15( 34368410):100369. 

Li, Elizabeth; Guo, Jun; Oh, So Jung; Luo, Yi; Oliveros, Heankel Cantu; Du, Wenqin; Arano, Rachel; Kim, Yerim; Chen, Yuh-Tarng; Eitson, Jennifer; Lin, Da-Ting; Li, Ying; Roberts, Todd; Schoggins, John W; Xu, Wei. Anterograde transneuronal tracing and genetic control with engineered yellow fever vaccine YFV-17D. Nature Methods. 2021;18(12):1542-1551. 

Ohara, Shinya; Yoshino, Rintaro; Kimura, Kei; Kawamura, Taichi; Tanabe, Soshi; Zheng, Andi; Nakamura, Shinya; Inoue, Ken-Ichi; Takada, Masahiko; Tsutsui, Ken-Ichiro; Witter, Menno P. Laminar Organization of the Entorhinal Cortex in Macaque Monkeys Based on Cell-Type-Specific Markers and Connectivity. Frontiers In Neural Circuits. 15( 34949991):790116. 

Kohara, Keigo; Pignatelli, Michele; Rivest, Alexander J; Jung, Hae-Yoon; Kitamura, Takashi; Suh, Junghyup; Frank, Dominic; Kajikawa, Koichiro; Mise, Nathan; Obata, Yuichi; Wickersham, Ian R; Tonegawa, Susumu. Cell type-specific genetic and optogenetic tools reveal hippocampal CA2 circuits. Nature Neuroscience. 2014;17(2):269-79. 

Hitti, Frederick L; Siegelbaum, Steven A. The hippocampal CA2 region is essential for social memory. Nature. 2014;508(7494):88-92. 

Botcher, Nicola A; Falck, Joanne E; Thomson, Alex M; Mercer, Audrey. Distribution of interneurons in the CA2 region of the rat hippocampus. Frontiers In Neuroanatomy. 8( 25309345):104. 

Zhou, Junhua; Shaikh, Lalarukh Haris; Neogi, Sudeshna G; McFarlane, Ian; Zhao, Wanfeng; Figg, Nichola; Brighton, Cheryl A; Maniero, Carmela; Teo, Ada E D; Azizan, Elena A B; Brown, Morris J. DACH1, a zona glomerulosa selective gene in the human adrenal, activates transforming growth factor-β signaling and suppresses aldosterone secretion. Hypertension (Dallas, Tex. : 1979). 2015;65(5):1103-10. 

Valero, Manuel; Cid, Elena; Averkin, Robert G; Aguilar, Juan; Sanchez-Aguilera, Alberto; Viney, Tim J; Gomez-Dominguez, Daniel; Bellistri, Elisa; de la Prida, Liset Menendez. Determinants of different deep and superficial CA1 pyramidal cell dynamics during sharp-wave ripples. Nature Neuroscience. 2015;18(9):1281-1290. 

Lopez-Pigozzi, Diego; Laurent, François; Brotons-Mas, Jorge R; Valderrama, Mario; Valero, Manuel; Fernandez-Lamo, Ivan; Cid, Elena; Gomez-Dominguez, Daniel; Gal, Beatriz; Menendez de la Prida, Liset. Altered Oscillatory Dynamics of CA1 Parvalbumin Basket Cells during Theta-Gamma Rhythmopathies of Temporal Lobe Epilepsy. Eneuro. 2016;3(6) 

Leroy, Felix; Brann, David H; Meira, Torcato; Siegelbaum, Steven A. Input-Timing-Dependent Plasticity in the Hippocampal CA2 Region and Its Potential Role in Social Memory. Neuron. 2017;95(5):1089-1102.e5. 

Cembrowski, Mark S; Wang, Lihua; Lemire, Andrew L; Copeland, Monique; DiLisio, Salvatore F; Clements, Jody; Spruston, Nelson. The subiculum is a patchwork of discrete subregions. Elife. 2018;7( 30375971) 

Suh, Jaehong; Romano, Donna M; Nitschke, Larissa; Herrick, Scott P; DiMarzio, Britt A; Dzhala, Volodymyr; Bae, Jun-Seok; Oram, Mary K; Zheng, Yuejiao; Hooli, Basavaraj; Mullin, Kristina; Gennarino, Vincenzo A; Wasco, Wilma; Schmahmann, Jeremy D; Albers, Mark W; Zoghbi, Huda Y; Tanzi, Rudolph E. Loss of Ataxin-1 Potentiates Alzheimer's Pathogenesis by Elevating Cerebral BACE1 Transcription. Cell. 2019;178(5):1159-1175.e17. 

Aji, Gulibositan; Li, Fang; Chen, Jiachao; Leng, Fei; Hu, Ke; Cheng, Ziyun; Luo, Yu; Xu, Xi; Zhang, Jing; Lu, Zhiqiang. Upregulation of PCP4 in human aldosterone-producing adenomas fosters human adrenocortical tumor cell growth via AKT and AMPK pathway. International Journal Of Clinical And Experimental Pathology. 11(3):1197-1207. 

Ding, Lingjun; Chen, Hongbiao; Diamantaki, Maria; Coletta, Stefano; Preston-Ferrer, Patricia; Burgalossi, Andrea. Structural Correlates of CA2 and CA3 Pyramidal Cell Activity in Freely-Moving Mice. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2020;40(30):5797-5806. 

Oliva, Azahara; Fernández-Ruiz, Antonio; Leroy, Felix; Siegelbaum, Steven A. Hippocampal CA2 sharp-wave ripples reactivate and promote social memory. Nature. 2020;587(7833):264-269. 

Beed, Prateep; Ray, Saikat; Velasquez, Laura Moreno; Stumpf, Alexander; Parthier, Daniel; Swaminathan, Aarti; Nitzan, Noam; Breustedt, Jörg; Las, Liora; Brecht, Michael; Schmitz, Dietmar. Species-specific differences in synaptic transmission and plasticity. Scientific Reports. 2020;10(1):16557. 

Laham, Blake J; Diethorn, Emma J; Gould, Elizabeth. Newborn mice form lasting CA2-dependent memories of their mothers. Cell Reports. 2021;34(4):108668. 

Sanders, Marie; Petrasch-Parwez, Elisabeth; Habbes, Hans-Werner; Düring, Monika V; Förster, Eckart. Postnatal Developmental Expression Profile Classifies the Indusium Griseum as a Distinct Subfield of the Hippocampal Formation. Frontiers In Cell And Developmental Biology. 8( 33511122):615571. 

Ohara, Shinya; Blankvoort, Stefan; Nair, Rajeevkumar Raveendran; Nigro, Maximiliano J; Nilssen, Eirik S; Kentros, Clifford; Witter, Menno P. Local projections of layer Vb-to-Va are more prominent in lateral than in medial entorhinal cortex. Elife. 2021;10( 33769282) 

Sanchez-Aguilera, Alberto; Wheeler, Diek W; Jurado-Parras, Teresa; Valero, Manuel; Nokia, Miriam S; Cid, Elena; Fernandez-Lamo, Ivan; Sutton, Nate; García-Rincón, Daniel; de la Prida, Liset M; Ascoli, Giorgio A. An update to Hippocampome.org by integrating single-cell phenotypes with circuit function in vivo. Plos Biology. 2021;19(5):e3001213. 

Leroy, Felix; de Solis, Christopher A; Boyle, Lara M; Bock, Tobias; Lofaro, Olivia M; Buss, Eric W; Asok, Arun; Kandel, Eric R; Siegelbaum, Steven A. Enkephalin release from VIP interneurons in the hippocampal CA2/3a region mediates heterosynaptic plasticity and social memory. Molecular Psychiatry. 2022;27(6):2879-2900. 

Robert, Vincent; Therreau, Ludivine; Chevaleyre, Vivien; Lepicard, Eude; Viollet, Cécile; Cognet, Julie; Huang, Arthur Jy; Boehringer, Roman; Polygalov, Denis; McHugh, Thomas J; Piskorowski, Rebecca Ann. Local circuit allowing hypothalamic control of hippocampal area CA2 activity and consequences for CA1. Elife. 2021;10( 34003113) 

Tang, Jiechang; Xue, Rou; Wang, Yan; Li, Min; Jia, Hongbo; Pakan, Janelle M P; Li, Longhui; Chen, Xiaowei; Li, Xingyi. Optical Fiber-Based Recording of Climbing Fiber Ca(2+) Signals in Freely Behaving Mice. Biology. 2022;11(6) 

Sheu, Shu-Hsien; Upadhyayula, Srigokul; Dupuy, Vincent; Pang, Song; Deng, Fei; Wan, Jinxia; Walpita, Deepika; Pasolli, H Amalia; Houser, Justin; Sanchez-Martinez, Silvia; Brauchi, Sebastian E; Banala, Sambashiva; Freeman, Melanie; Xu, C Shan; Kirchhausen, Tom; Hess, Harald F; Lavis, Luke; Li, Yulong; Chaumont-Dubel, Séverine; Clapham, David E. A serotonergic axon-cilium synapse drives nuclear signaling to alter chromatin accessibility. Cell. 2022;185(18):3390-3407.e18. 

Kitanishi, Takuma; Umaba, Ryoko; Mizuseki, Kenji. Robust information routing by dorsal subiculum neurons. Science Advances. 2021;7(11) 

Sheintuch, Liron; Geva, Nitzan; Deitch, Daniel; Rubin, Alon; Ziv, Yaniv. Organization of hippocampal CA3 into correlated cell assemblies supports a stable spatial code. Cell Reports. 2023;42(2):112119.