Anti PCNX2 pAb (ATL-HPA013815)
Atlas Antibodies
- Catalog No.:
- ATL-HPA013815-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PCNX2
Alternative Gene Name: FLJ11383, KIAA0435, PCNXL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060212: 61%, ENSRNOG00000028580: 65%
Entrez Gene ID: 80003
Uniprot ID: A6NKB5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SYRLHLMFDKGEVIQQKPSRKEEKPNKDKEA |
| Gene Sequence | SYRLHLMFDKGEVIQQKPSRKEEKPNKDKEA |
| Gene ID - Mouse | ENSMUSG00000060212 |
| Gene ID - Rat | ENSRNOG00000028580 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PCNX2 pAb (ATL-HPA013815) | |
| Datasheet | Anti PCNX2 pAb (ATL-HPA013815) Datasheet (External Link) |
| Vendor Page | Anti PCNX2 pAb (ATL-HPA013815) at Atlas Antibodies |
| Documents & Links for Anti PCNX2 pAb (ATL-HPA013815) | |
| Datasheet | Anti PCNX2 pAb (ATL-HPA013815) Datasheet (External Link) |
| Vendor Page | Anti PCNX2 pAb (ATL-HPA013815) |