Anti PCNX2 pAb (ATL-HPA013815)

Atlas Antibodies

Catalog No.:
ATL-HPA013815-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: pecanex homolog 2 (Drosophila)
Gene Name: PCNX2
Alternative Gene Name: FLJ11383, KIAA0435, PCNXL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060212: 61%, ENSRNOG00000028580: 65%
Entrez Gene ID: 80003
Uniprot ID: A6NKB5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SYRLHLMFDKGEVIQQKPSRKEEKPNKDKEA
Gene Sequence SYRLHLMFDKGEVIQQKPSRKEEKPNKDKEA
Gene ID - Mouse ENSMUSG00000060212
Gene ID - Rat ENSRNOG00000028580
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PCNX2 pAb (ATL-HPA013815)
Datasheet Anti PCNX2 pAb (ATL-HPA013815) Datasheet (External Link)
Vendor Page Anti PCNX2 pAb (ATL-HPA013815) at Atlas Antibodies

Documents & Links for Anti PCNX2 pAb (ATL-HPA013815)
Datasheet Anti PCNX2 pAb (ATL-HPA013815) Datasheet (External Link)
Vendor Page Anti PCNX2 pAb (ATL-HPA013815)