Anti PCNT pAb (ATL-HPA019887 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA019887-25

Protein Description: pericentrin
Gene Name: PCNT
Alternative Gene Name: KEN, KIAA0402, PCN, PCNT2, PCNTB, SCKL4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001151: 58%, ENSRNOG00000001276: 58%
Entrez Gene ID: 5116
Uniprot ID: O95613
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MLDLSSWSSPEVLRKDWTLEPWPSLPVTPHSGALSLCSADTSLGDRADTSLPQTQGPGLLCSPGVSAAALALQWAESPPADDHHVQRTAVEKDVEDFITTSFDSQETLSSPPPGLEGKADRSEKSDGSG
• Gene Sequence: MLDLSSWSSPEVLRKDWTLEPWPSLPVTPHSGALSLCSADTSLGDRADTSLPQTQGPGLLCSPGVSAAALALQWAESPPADDHHVQRTAVEKDVEDFITTSFDSQETLSSPPPGLEGKADRSEKSDGSG
• Gene ID - Mouse: ENSMUSG00000001151
• Gene ID - Rat: ENSRNOG00000001276
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PCNT pAb (ATL-HPA019887 w/enhanced validation) – 2 Found

Casar Tena, Teresa; Maerz, Lars D; Szafranski, Karol; Groth, Marco; Blätte, Tamara J; Donow, Cornelia; Matysik, Sabrina; Walther, Paul; Jeggo, Penelope A; Burkhalter, Martin D; Philipp, Melanie. Resting cells rely on the DNA helicase component MCM2 to build cilia. Nucleic Acids Research. 2019;47(1):134-151. 

Bieder, Andrea; Yoshihara, Masahito; Katayama, Shintaro; Krjutškov, Kaarel; Falk, Anna; Kere, Juha; Tapia-Páez, Isabel. Dyslexia Candidate Gene and Ciliary Gene Expression Dynamics During Human Neuronal Differentiation. Molecular Neurobiology. 2020;57(7):2944-2958.