Anti PCMTD2 pAb (ATL-HPA057849)

Atlas Antibodies

SKU: ATL-HPA057849-25

• 
• 

Protein Description: protein-L-isoaspartate (D-aspartate) O-methyltransferase domain containing 2
Gene Name: PCMTD2
Alternative Gene Name: C20orf36, FLJ10883
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027589: 74%, ENSRNOG00000017404: 72%
Entrez Gene ID: 55251
Uniprot ID: Q9NV79
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KIIHQETVSKNGNGLKNTPRFKRRRVRRRRMETIVFLDKEVFASRISNPSDDNSCEDL
• Gene Sequence: KIIHQETVSKNGNGLKNTPRFKRRRVRRRRMETIVFLDKEVFASRISNPSDDNSCEDL
• Gene ID - Mouse: ENSMUSG00000027589
• Gene ID - Rat: ENSRNOG00000017404
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.