Anti PCMTD2 pAb (ATL-HPA057849)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057849-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PCMTD2
Alternative Gene Name: C20orf36, FLJ10883
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027589: 74%, ENSRNOG00000017404: 72%
Entrez Gene ID: 55251
Uniprot ID: Q9NV79
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KIIHQETVSKNGNGLKNTPRFKRRRVRRRRMETIVFLDKEVFASRISNPSDDNSCEDL |
Gene Sequence | KIIHQETVSKNGNGLKNTPRFKRRRVRRRRMETIVFLDKEVFASRISNPSDDNSCEDL |
Gene ID - Mouse | ENSMUSG00000027589 |
Gene ID - Rat | ENSRNOG00000017404 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PCMTD2 pAb (ATL-HPA057849) | |
Datasheet | Anti PCMTD2 pAb (ATL-HPA057849) Datasheet (External Link) |
Vendor Page | Anti PCMTD2 pAb (ATL-HPA057849) at Atlas Antibodies |
Documents & Links for Anti PCMTD2 pAb (ATL-HPA057849) | |
Datasheet | Anti PCMTD2 pAb (ATL-HPA057849) Datasheet (External Link) |
Vendor Page | Anti PCMTD2 pAb (ATL-HPA057849) |