Anti PCMTD1 pAb (ATL-HPA061444)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061444-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PCMTD1
Alternative Gene Name: FLJ10883
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051285: 100%, ENSRNOG00000005730: 100%
Entrez Gene ID: 115294
Uniprot ID: Q96MG8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DLARIYIRRTLRNFINDEMQAKGIPQRAPPKRKRKRVKQRINTYVF |
Gene Sequence | DLARIYIRRTLRNFINDEMQAKGIPQRAPPKRKRKRVKQRINTYVF |
Gene ID - Mouse | ENSMUSG00000051285 |
Gene ID - Rat | ENSRNOG00000005730 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PCMTD1 pAb (ATL-HPA061444) | |
Datasheet | Anti PCMTD1 pAb (ATL-HPA061444) Datasheet (External Link) |
Vendor Page | Anti PCMTD1 pAb (ATL-HPA061444) at Atlas Antibodies |
Documents & Links for Anti PCMTD1 pAb (ATL-HPA061444) | |
Datasheet | Anti PCMTD1 pAb (ATL-HPA061444) Datasheet (External Link) |
Vendor Page | Anti PCMTD1 pAb (ATL-HPA061444) |