Anti PCLO pAb (ATL-HPA029579)

Atlas Antibodies

Catalog No.: ATL-HPA029579-25

Protein Description: piccolo presynaptic cytomatrix protein
Gene Name: PCLO
Alternative Gene Name: ACZ, DKFZp779G1236, KIAA0559
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061601: 70%, ENSRNOG00000005726: 72%
Entrez Gene ID: 27445
Uniprot ID: Q9Y6V0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PITTLDSITTVYTEPVDMITKFEDSEEISSSTYFPGSIIDYPEEISVSLDRTAPPDGRASADHIVISLSDMASSIIESVVPKPEGPVADTVSTDLLISEKDPVKKAKKETGNGIILEVLEA
• Gene Sequence: PITTLDSITTVYTEPVDMITKFEDSEEISSSTYFPGSIIDYPEEISVSLDRTAPPDGRASADHIVISLSDMASSIIESVVPKPEGPVADTVSTDLLISEKDPVKKAKKETGNGIILEVLEA
• Gene ID - Mouse: ENSMUSG00000061601
• Gene ID - Rat: ENSRNOG00000005726
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.