Anti PCGF5 pAb (ATL-HPA059071)

Atlas Antibodies

SKU:
ATL-HPA059071-25
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & the Golgi apparatus.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: polycomb group ring finger 5
Gene Name: PCGF5
Alternative Gene Name: MGC16202, RNF159
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024805: 95%, ENSRNOG00000018532: 68%
Entrez Gene ID: 84333
Uniprot ID: Q86SE9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DVLCNGEIMGKDHTMEFIYMTRWRLRGENFRCLNCSASQVCSQDGPLYQSYPMVLQYRPRID
Gene Sequence DVLCNGEIMGKDHTMEFIYMTRWRLRGENFRCLNCSASQVCSQDGPLYQSYPMVLQYRPRID
Gene ID - Mouse ENSMUSG00000024805
Gene ID - Rat ENSRNOG00000018532
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PCGF5 pAb (ATL-HPA059071)
Datasheet Anti PCGF5 pAb (ATL-HPA059071) Datasheet (External Link)
Vendor Page Anti PCGF5 pAb (ATL-HPA059071) at Atlas Antibodies

Documents & Links for Anti PCGF5 pAb (ATL-HPA059071)
Datasheet Anti PCGF5 pAb (ATL-HPA059071) Datasheet (External Link)
Vendor Page Anti PCGF5 pAb (ATL-HPA059071)