Anti PCGF1 pAb (ATL-HPA069156)

Atlas Antibodies

Catalog No.:
ATL-HPA069156-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: polycomb group ring finger 1
Gene Name: PCGF1
Alternative Gene Name: MGC10882, NSPC1, RNF68
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069678: 100%, ENSRNOG00000051433: 100%
Entrez Gene ID: 84759
Uniprot ID: Q9BSM1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MASPQGGQIAIAMRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDA
Gene Sequence MASPQGGQIAIAMRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDA
Gene ID - Mouse ENSMUSG00000069678
Gene ID - Rat ENSRNOG00000051433
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PCGF1 pAb (ATL-HPA069156)
Datasheet Anti PCGF1 pAb (ATL-HPA069156) Datasheet (External Link)
Vendor Page Anti PCGF1 pAb (ATL-HPA069156) at Atlas Antibodies

Documents & Links for Anti PCGF1 pAb (ATL-HPA069156)
Datasheet Anti PCGF1 pAb (ATL-HPA069156) Datasheet (External Link)
Vendor Page Anti PCGF1 pAb (ATL-HPA069156)