Anti PCDHGB2 pAb (ATL-HPA077526)

Atlas Antibodies

SKU:
ATL-HPA077526-25
  • Immunofluorescent staining of human cell line RH-30 shows localization to plasma membrane, cytosol & vesicles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: protocadherin gamma subfamily B, 2
Gene Name: PCDHGB2
Alternative Gene Name: PCDH-GAMMA-B2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000102748: 71%, ENSRNOG00000039461: 55%
Entrez Gene ID: 56103
Uniprot ID: Q9Y5G2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLFKQTKINLKIGESTKPGTTFPLDPALDSDVGPNSLQRYHLNDNEYFDLAEKQTPDGRKYP
Gene Sequence PLFKQTKINLKIGESTKPGTTFPLDPALDSDVGPNSLQRYHLNDNEYFDLAEKQTPDGRKYP
Gene ID - Mouse ENSMUSG00000102748
Gene ID - Rat ENSRNOG00000039461
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PCDHGB2 pAb (ATL-HPA077526)
Datasheet Anti PCDHGB2 pAb (ATL-HPA077526) Datasheet (External Link)
Vendor Page Anti PCDHGB2 pAb (ATL-HPA077526) at Atlas Antibodies

Documents & Links for Anti PCDHGB2 pAb (ATL-HPA077526)
Datasheet Anti PCDHGB2 pAb (ATL-HPA077526) Datasheet (External Link)
Vendor Page Anti PCDHGB2 pAb (ATL-HPA077526)