Anti PCDHGB1 pAb (ATL-HPA076182)
Atlas Antibodies
- SKU:
- ATL-HPA076182-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PCDHGB1
Alternative Gene Name: PCDH-GAMMA-B1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000103037: 79%, ENSRNOG00000042264: 75%
Entrez Gene ID: 56104
Uniprot ID: Q9Y5G3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | INAEITYAFLNSPISTSLFNLNPNTGDITTNGTLDFEETSRYVLSVEAKDG |
Gene Sequence | INAEITYAFLNSPISTSLFNLNPNTGDITTNGTLDFEETSRYVLSVEAKDG |
Gene ID - Mouse | ENSMUSG00000103037 |
Gene ID - Rat | ENSRNOG00000042264 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PCDHGB1 pAb (ATL-HPA076182) | |
Datasheet | Anti PCDHGB1 pAb (ATL-HPA076182) Datasheet (External Link) |
Vendor Page | Anti PCDHGB1 pAb (ATL-HPA076182) at Atlas Antibodies |
Documents & Links for Anti PCDHGB1 pAb (ATL-HPA076182) | |
Datasheet | Anti PCDHGB1 pAb (ATL-HPA076182) Datasheet (External Link) |
Vendor Page | Anti PCDHGB1 pAb (ATL-HPA076182) |