Anti PCDHGB1 pAb (ATL-HPA076182)
Atlas Antibodies
- Catalog No.:
- ATL-HPA076182-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PCDHGB1
Alternative Gene Name: PCDH-GAMMA-B1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000103037: 79%, ENSRNOG00000042264: 75%
Entrez Gene ID: 56104
Uniprot ID: Q9Y5G3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | INAEITYAFLNSPISTSLFNLNPNTGDITTNGTLDFEETSRYVLSVEAKDG |
| Gene Sequence | INAEITYAFLNSPISTSLFNLNPNTGDITTNGTLDFEETSRYVLSVEAKDG |
| Gene ID - Mouse | ENSMUSG00000103037 |
| Gene ID - Rat | ENSRNOG00000042264 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PCDHGB1 pAb (ATL-HPA076182) | |
| Datasheet | Anti PCDHGB1 pAb (ATL-HPA076182) Datasheet (External Link) |
| Vendor Page | Anti PCDHGB1 pAb (ATL-HPA076182) at Atlas Antibodies |
| Documents & Links for Anti PCDHGB1 pAb (ATL-HPA076182) | |
| Datasheet | Anti PCDHGB1 pAb (ATL-HPA076182) Datasheet (External Link) |
| Vendor Page | Anti PCDHGB1 pAb (ATL-HPA076182) |