Anti PCDHGA2 pAb (ATL-HPA038625)

Atlas Antibodies

Catalog No.: ATL-HPA038625-25

Protein Description: protocadherin gamma subfamily A, 2
Gene Name: PCDHGA2
Alternative Gene Name: PCDH-GAMMA-A2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000103332: 73%, ENSRNOG00000034126: 71%
Entrez Gene ID: 56113
Uniprot ID: Q9Y5H1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ADEGYYAQVVYFLEKSPGETSEVFELKSTSGELTIIKDLDYEDATFHEIDI
• Gene Sequence: ADEGYYAQVVYFLEKSPGETSEVFELKSTSGELTIIKDLDYEDATFHEIDI
• Gene ID - Mouse: ENSMUSG00000103332
• Gene ID - Rat: ENSRNOG00000034126
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.