Anti PCDHB5 pAb (ATL-HPA067473)

Atlas Antibodies

Catalog No.:
ATL-HPA067473-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: protocadherin beta 5
Gene Name: PCDHB5
Alternative Gene Name: DKFZp586B0217, PCDH-BETA5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045657: 78%, ENSRNOG00000020073: 72%
Entrez Gene ID: 26167
Uniprot ID: Q9Y5E4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DAGAYGSVAYALFQGDEVTQPFVIDEKTAEIRLKRALDFEATPYYNVEIV
Gene Sequence DAGAYGSVAYALFQGDEVTQPFVIDEKTAEIRLKRALDFEATPYYNVEIV
Gene ID - Mouse ENSMUSG00000045657
Gene ID - Rat ENSRNOG00000020073
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PCDHB5 pAb (ATL-HPA067473)
Datasheet Anti PCDHB5 pAb (ATL-HPA067473) Datasheet (External Link)
Vendor Page Anti PCDHB5 pAb (ATL-HPA067473) at Atlas Antibodies

Documents & Links for Anti PCDHB5 pAb (ATL-HPA067473)
Datasheet Anti PCDHB5 pAb (ATL-HPA067473) Datasheet (External Link)
Vendor Page Anti PCDHB5 pAb (ATL-HPA067473)