Anti PCDHB10 pAb (ATL-HPA013445)

Atlas Antibodies

Catalog No.:
ATL-HPA013445-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: protocadherin beta 10
Gene Name: PCDHB10
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048347: 80%, ENSRNOG00000020054: 64%
Entrez Gene ID: 56126
Uniprot ID: Q9UN67
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VVNLAKDLGLAEGELAARGTRVVSDDNKQYLLLDSHTGNLLTNEKLDREKLCGPKEPCMLYFQILMDDPFQIYRAELRVRDINDHAPVFQDKETVLKISENTAEGTAFRLERAQDPDGGLNGIQNYTISPNSF
Gene Sequence VVNLAKDLGLAEGELAARGTRVVSDDNKQYLLLDSHTGNLLTNEKLDREKLCGPKEPCMLYFQILMDDPFQIYRAELRVRDINDHAPVFQDKETVLKISENTAEGTAFRLERAQDPDGGLNGIQNYTISPNSF
Gene ID - Mouse ENSMUSG00000048347
Gene ID - Rat ENSRNOG00000020054
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PCDHB10 pAb (ATL-HPA013445)
Datasheet Anti PCDHB10 pAb (ATL-HPA013445) Datasheet (External Link)
Vendor Page Anti PCDHB10 pAb (ATL-HPA013445) at Atlas Antibodies

Documents & Links for Anti PCDHB10 pAb (ATL-HPA013445)
Datasheet Anti PCDHB10 pAb (ATL-HPA013445) Datasheet (External Link)
Vendor Page Anti PCDHB10 pAb (ATL-HPA013445)