Anti PCDHB1 pAb (ATL-HPA053921)

Atlas Antibodies

Catalog No.:
ATL-HPA053921-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: protocadherin beta 1
Gene Name: PCDHB1
Alternative Gene Name: PCDH-BETA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051663: 93%, ENSRNOG00000020103: 92%
Entrez Gene ID: 29930
Uniprot ID: Q9Y5F3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IQEHFYDDCNFSNNLVQGQGNGSLSRPCPYEMCSATGTGNSEFRFLKRFMPNFPFPHATGE
Gene Sequence IQEHFYDDCNFSNNLVQGQGNGSLSRPCPYEMCSATGTGNSEFRFLKRFMPNFPFPHATGE
Gene ID - Mouse ENSMUSG00000051663
Gene ID - Rat ENSRNOG00000020103
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PCDHB1 pAb (ATL-HPA053921)
Datasheet Anti PCDHB1 pAb (ATL-HPA053921) Datasheet (External Link)
Vendor Page Anti PCDHB1 pAb (ATL-HPA053921) at Atlas Antibodies

Documents & Links for Anti PCDHB1 pAb (ATL-HPA053921)
Datasheet Anti PCDHB1 pAb (ATL-HPA053921) Datasheet (External Link)
Vendor Page Anti PCDHB1 pAb (ATL-HPA053921)