Anti PCDHA11 pAb (ATL-HPA077160)

Atlas Antibodies

Catalog No.: ATL-HPA077160-25

Protein Description: protocadherin alpha 11
Gene Name: PCDHA11
Alternative Gene Name: CNR7, CNRN7, CNRS7, CRNR7, PCDH-ALPHA11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000102206: 79%, ENSRNOG00000020119: 81%
Entrez Gene ID: 56138
Uniprot ID: Q9Y5I1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VNGEVTYSLMSIKPNGRHLFTLDQNNGEVRVNGTLDYEENKFYKIEVQATDK
• Gene Sequence: VNGEVTYSLMSIKPNGRHLFTLDQNNGEVRVNGTLDYEENKFYKIEVQATDK
• Gene ID - Mouse: ENSMUSG00000102206
• Gene ID - Rat: ENSRNOG00000020119
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.