Anti PCDHA11 pAb (ATL-HPA077160)

Atlas Antibodies

Catalog No.:
ATL-HPA077160-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: protocadherin alpha 11
Gene Name: PCDHA11
Alternative Gene Name: CNR7, CNRN7, CNRS7, CRNR7, PCDH-ALPHA11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000102206: 79%, ENSRNOG00000020119: 81%
Entrez Gene ID: 56138
Uniprot ID: Q9Y5I1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VNGEVTYSLMSIKPNGRHLFTLDQNNGEVRVNGTLDYEENKFYKIEVQATDK
Gene Sequence VNGEVTYSLMSIKPNGRHLFTLDQNNGEVRVNGTLDYEENKFYKIEVQATDK
Gene ID - Mouse ENSMUSG00000102206
Gene ID - Rat ENSRNOG00000020119
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PCDHA11 pAb (ATL-HPA077160)
Datasheet Anti PCDHA11 pAb (ATL-HPA077160) Datasheet (External Link)
Vendor Page Anti PCDHA11 pAb (ATL-HPA077160) at Atlas Antibodies

Documents & Links for Anti PCDHA11 pAb (ATL-HPA077160)
Datasheet Anti PCDHA11 pAb (ATL-HPA077160) Datasheet (External Link)
Vendor Page Anti PCDHA11 pAb (ATL-HPA077160)