Anti PCDH7 pAb (ATL-HPA011866)
Atlas Antibodies
- Catalog No.:
- ATL-HPA011866-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PCDH7
Alternative Gene Name: BH-Pcdh, PPP1R120
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029108: 99%, ENSRNOG00000012367: 99%
Entrez Gene ID: 5099
Uniprot ID: O60245
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SGEVTFSLESGSEYLKIDNLTGELSTSERRIDREKLPQCQMIFDENECFLDFEVSVIGPSQSWVDLFEGQVIVLDINDNTPTFPSPVLTLTVEENRPVGTLYLLPT |
| Gene Sequence | SGEVTFSLESGSEYLKIDNLTGELSTSERRIDREKLPQCQMIFDENECFLDFEVSVIGPSQSWVDLFEGQVIVLDINDNTPTFPSPVLTLTVEENRPVGTLYLLPT |
| Gene ID - Mouse | ENSMUSG00000029108 |
| Gene ID - Rat | ENSRNOG00000012367 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PCDH7 pAb (ATL-HPA011866) | |
| Datasheet | Anti PCDH7 pAb (ATL-HPA011866) Datasheet (External Link) |
| Vendor Page | Anti PCDH7 pAb (ATL-HPA011866) at Atlas Antibodies |
| Documents & Links for Anti PCDH7 pAb (ATL-HPA011866) | |
| Datasheet | Anti PCDH7 pAb (ATL-HPA011866) Datasheet (External Link) |
| Vendor Page | Anti PCDH7 pAb (ATL-HPA011866) |
| Citations for Anti PCDH7 pAb (ATL-HPA011866) – 2 Found |
| Beggs, Andrew D; Jones, Angela; Shepherd, Neil; Arnaout, Abed; Finlayson, Caroline; Abulafi, A Muti; Morton, Dion G; Matthews, Glenn M; Hodgson, Shirley V; Tomlinson, Ian P M. Loss of expression and promoter methylation of SLIT2 are associated with sessile serrated adenoma formation. Plos Genetics. 2013;9(5):e1003488. PubMed |
| Konermann, Silvana; Brigham, Mark D; Trevino, Alexandro E; Joung, Julia; Abudayyeh, Omar O; Barcena, Clea; Hsu, Patrick D; Habib, Naomi; Gootenberg, Jonathan S; Nishimasu, Hiroshi; Nureki, Osamu; Zhang, Feng. Genome-scale transcriptional activation by an engineered CRISPR-Cas9 complex. Nature. 2015;517(7536):583-8. PubMed |