Anti PCDH7 pAb (ATL-HPA011866)

Atlas Antibodies

Catalog No.:
ATL-HPA011866-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: protocadherin 7
Gene Name: PCDH7
Alternative Gene Name: BH-Pcdh, PPP1R120
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029108: 99%, ENSRNOG00000012367: 99%
Entrez Gene ID: 5099
Uniprot ID: O60245
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGEVTFSLESGSEYLKIDNLTGELSTSERRIDREKLPQCQMIFDENECFLDFEVSVIGPSQSWVDLFEGQVIVLDINDNTPTFPSPVLTLTVEENRPVGTLYLLPT
Gene Sequence SGEVTFSLESGSEYLKIDNLTGELSTSERRIDREKLPQCQMIFDENECFLDFEVSVIGPSQSWVDLFEGQVIVLDINDNTPTFPSPVLTLTVEENRPVGTLYLLPT
Gene ID - Mouse ENSMUSG00000029108
Gene ID - Rat ENSRNOG00000012367
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PCDH7 pAb (ATL-HPA011866)
Datasheet Anti PCDH7 pAb (ATL-HPA011866) Datasheet (External Link)
Vendor Page Anti PCDH7 pAb (ATL-HPA011866) at Atlas Antibodies

Documents & Links for Anti PCDH7 pAb (ATL-HPA011866)
Datasheet Anti PCDH7 pAb (ATL-HPA011866) Datasheet (External Link)
Vendor Page Anti PCDH7 pAb (ATL-HPA011866)
Citations for Anti PCDH7 pAb (ATL-HPA011866) – 2 Found
Beggs, Andrew D; Jones, Angela; Shepherd, Neil; Arnaout, Abed; Finlayson, Caroline; Abulafi, A Muti; Morton, Dion G; Matthews, Glenn M; Hodgson, Shirley V; Tomlinson, Ian P M. Loss of expression and promoter methylation of SLIT2 are associated with sessile serrated adenoma formation. Plos Genetics. 2013;9(5):e1003488.  PubMed
Konermann, Silvana; Brigham, Mark D; Trevino, Alexandro E; Joung, Julia; Abudayyeh, Omar O; Barcena, Clea; Hsu, Patrick D; Habib, Naomi; Gootenberg, Jonathan S; Nishimasu, Hiroshi; Nureki, Osamu; Zhang, Feng. Genome-scale transcriptional activation by an engineered CRISPR-Cas9 complex. Nature. 2015;517(7536):583-8.  PubMed