Anti PCDH20 pAb (ATL-HPA062669)

Atlas Antibodies

Catalog No.:
ATL-HPA062669-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: protocadherin 20
Gene Name: PCDH20
Alternative Gene Name: FLJ22218, PCDH13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050505: 86%, ENSRNOG00000013306: 88%
Entrez Gene ID: 64881
Uniprot ID: Q8N6Y1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GAEWNPPLSFSLASRGLSGQYVTLDNRSGELHTSAQEIDREALCVEGGGGTAWSGSVSISSSPSDSCLLLLDVLVLPQEYFRFV
Gene Sequence GAEWNPPLSFSLASRGLSGQYVTLDNRSGELHTSAQEIDREALCVEGGGGTAWSGSVSISSSPSDSCLLLLDVLVLPQEYFRFV
Gene ID - Mouse ENSMUSG00000050505
Gene ID - Rat ENSRNOG00000013306
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PCDH20 pAb (ATL-HPA062669)
Datasheet Anti PCDH20 pAb (ATL-HPA062669) Datasheet (External Link)
Vendor Page Anti PCDH20 pAb (ATL-HPA062669) at Atlas Antibodies

Documents & Links for Anti PCDH20 pAb (ATL-HPA062669)
Datasheet Anti PCDH20 pAb (ATL-HPA062669) Datasheet (External Link)
Vendor Page Anti PCDH20 pAb (ATL-HPA062669)