Anti PCDH17 pAb (ATL-HPA026817)

Atlas Antibodies

SKU:
ATL-HPA026817-25
  • Immunohistochemical staining of human liver shows strong membranous positivity in hepatocytes.
  • Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane, cytosol & vesicles.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: protocadherin 17
Gene Name: PCDH17
Alternative Gene Name: PCDH68, PCH68
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035566: 100%, ENSRNOG00000008970: 100%
Entrez Gene ID: 27253
Uniprot ID: O14917
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VNDNAPVIVLPTLQNDTAELQVPRNAGLGYLVSTVRALDSDFGESGRLTYEIVDGNDDHLFEIDPSSGEIRTLHPFWEDVTPVVELVVKVTDHGKPTLSAVAKLIIRSVSGSLPEGVPRVNGEQHHWD
Gene Sequence VNDNAPVIVLPTLQNDTAELQVPRNAGLGYLVSTVRALDSDFGESGRLTYEIVDGNDDHLFEIDPSSGEIRTLHPFWEDVTPVVELVVKVTDHGKPTLSAVAKLIIRSVSGSLPEGVPRVNGEQHHWD
Gene ID - Mouse ENSMUSG00000035566
Gene ID - Rat ENSRNOG00000008970
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PCDH17 pAb (ATL-HPA026817)
Datasheet Anti PCDH17 pAb (ATL-HPA026817) Datasheet (External Link)
Vendor Page Anti PCDH17 pAb (ATL-HPA026817) at Atlas Antibodies

Documents & Links for Anti PCDH17 pAb (ATL-HPA026817)
Datasheet Anti PCDH17 pAb (ATL-HPA026817) Datasheet (External Link)
Vendor Page Anti PCDH17 pAb (ATL-HPA026817)



Citations for Anti PCDH17 pAb (ATL-HPA026817) – 3 Found
Yin, Xuedong; Xiang, Tingxiu; Mu, Junhao; Mao, Haitao; Li, Lili; Huang, Xin; Li, Chunhong; Feng, Yixiao; Luo, Xinrong; Wei, Yuxian; Peng, Weiyan; Ren, Guosheng; Tao, Qian. Protocadherin 17 functions as a tumor suppressor suppressing Wnt/β-catenin signaling and cell metastasis and is frequently methylated in breast cancer. Oncotarget. 2016;7(32):51720-51732.  PubMed
Chen, Liuxi; Liu, Ying; Zhang, Qi; Zhang, Mingming; Han, Xuemeng; Li, Qiujie; Xie, Tian; Wu, Qibiao; Sui, Xinbing. p53/PCDH17/Beclin-1 Proteins as Prognostic Predictors for Urinary Bladder Cancer. Journal Of Cancer. 10(25):6207-6216.  PubMed
Liu, Shuiping; Lin, Haoming; Wang, Da; Li, Qiang; Luo, Hong; Li, Guoxiong; Chen, Xiaohui; Li, Yongqiang; Chen, Peng; Zhai, Bingtao; Wang, Wengang; Zhang, Ruonan; Chen, Bi; Zhang, Mingming; Han, Xuemeng; Li, Qiujie; Chen, Liuxi; Liu, Ying; Chen, Xiaying; Li, Guohua; Xiang, Yu; Duan, Ting; Feng, Jiao; Lou, Jianshu; Huang, Xingxing; Zhang, Qin; Pan, Ting; Yan, Lili; Jin, Ting; Zhang, Wenzheng; Zhuo, Lvjia; Sun, Yitian; Xie, Tian; Sui, Xinbing. PCDH17 increases the sensitivity of colorectal cancer to 5-fluorouracil treatment by inducing apoptosis and autophagic cell death. Signal Transduction And Targeted Therapy. 4( 31815010):53.  PubMed