Anti PCDH10 pAb (ATL-HPA073462)

Atlas Antibodies

SKU:
ATL-HPA073462-25
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & the Golgi apparatus.
Shipping:
Calculated at Checkout
$447.00
On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.
Adding to cart… The item has been added
Protein Description: protocadherin 10
Gene Name: PCDH10
Alternative Gene Name: KIAA1400, OL-PCDH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049100: 94%, ENSRNOG00000031974: 94%
Entrez Gene ID: 57575
Uniprot ID: Q9P2E7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MPSFVPSDGRQAADYRSNLHVPGMDSVPDTEVFETPEAQPGAERSFSTFGKEKALHSTLERKELDGLLTNT
Gene Sequence MPSFVPSDGRQAADYRSNLHVPGMDSVPDTEVFETPEAQPGAERSFSTFGKEKALHSTLERKELDGLLTNT
Gene ID - Mouse ENSMUSG00000049100
Gene ID - Rat ENSRNOG00000031974
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PCDH10 pAb (ATL-HPA073462)
Datasheet Anti PCDH10 pAb (ATL-HPA073462) Datasheet (External Link)
Vendor Page Anti PCDH10 pAb (ATL-HPA073462) at Atlas Antibodies

Documents & Links for Anti PCDH10 pAb (ATL-HPA073462)
Datasheet Anti PCDH10 pAb (ATL-HPA073462) Datasheet (External Link)
Vendor Page Anti PCDH10 pAb (ATL-HPA073462)