Anti PCDH1 pAb (ATL-HPA050538 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050538-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PCDH1
Alternative Gene Name: pc42
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051375: 96%, ENSRNOG00000060410: 94%
Entrez Gene ID: 5097
Uniprot ID: Q08174
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TRVVYKVPEEQPPNTLIGSLAADYGFPDVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLVQN |
| Gene Sequence | TRVVYKVPEEQPPNTLIGSLAADYGFPDVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLVQN |
| Gene ID - Mouse | ENSMUSG00000051375 |
| Gene ID - Rat | ENSRNOG00000060410 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PCDH1 pAb (ATL-HPA050538 w/enhanced validation) | |
| Datasheet | Anti PCDH1 pAb (ATL-HPA050538 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PCDH1 pAb (ATL-HPA050538 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti PCDH1 pAb (ATL-HPA050538 w/enhanced validation) | |
| Datasheet | Anti PCDH1 pAb (ATL-HPA050538 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PCDH1 pAb (ATL-HPA050538 w/enhanced validation) |
| Citations for Anti PCDH1 pAb (ATL-HPA050538 w/enhanced validation) – 1 Found |
| Ye, Zhihua; Yang, Yingyu; Wei, Ying; Li, Lamei; Wang, Xinyi; Zhang, Junkai. PCDH1 promotes progression of pancreatic ductal adenocarcinoma via activation of NF-κB signalling by interacting with KPNB1. Cell Death & Disease. 2022;13(7):633. PubMed |