Anti PCDH1 pAb (ATL-HPA047720 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA047720-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: protocadherin 1
Gene Name: PCDH1
Alternative Gene Name: pc42
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051375: 95%, ENSRNOG00000060410: 95%
Entrez Gene ID: 5097
Uniprot ID: Q08174
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKSGYQAGKKETKDLYAPKPSGKASKGNKSKGKKSKSPKPVKPVEDEDEAGLQKSLKFNLMSDAPGDSPRIHLPLNYPP
Gene Sequence AKSGYQAGKKETKDLYAPKPSGKASKGNKSKGKKSKSPKPVKPVEDEDEAGLQKSLKFNLMSDAPGDSPRIHLPLNYPP
Gene ID - Mouse ENSMUSG00000051375
Gene ID - Rat ENSRNOG00000060410
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PCDH1 pAb (ATL-HPA047720 w/enhanced validation)
Datasheet Anti PCDH1 pAb (ATL-HPA047720 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PCDH1 pAb (ATL-HPA047720 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PCDH1 pAb (ATL-HPA047720 w/enhanced validation)
Datasheet Anti PCDH1 pAb (ATL-HPA047720 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PCDH1 pAb (ATL-HPA047720 w/enhanced validation)