Anti PCDH1 pAb (ATL-HPA047720 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA047720-100

Protein Description: protocadherin 1
Gene Name: PCDH1
Alternative Gene Name: pc42
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051375: 95%, ENSRNOG00000060410: 95%
Entrez Gene ID: 5097
Uniprot ID: Q08174
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AKSGYQAGKKETKDLYAPKPSGKASKGNKSKGKKSKSPKPVKPVEDEDEAGLQKSLKFNLMSDAPGDSPRIHLPLNYPP
• Gene Sequence: AKSGYQAGKKETKDLYAPKPSGKASKGNKSKGKKSKSPKPVKPVEDEDEAGLQKSLKFNLMSDAPGDSPRIHLPLNYPP
• Gene ID - Mouse: ENSMUSG00000051375
• Gene ID - Rat: ENSRNOG00000060410
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.