Anti PCDH1 pAb (ATL-HPA047720 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047720-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: PCDH1
Alternative Gene Name: pc42
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051375: 95%, ENSRNOG00000060410: 95%
Entrez Gene ID: 5097
Uniprot ID: Q08174
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AKSGYQAGKKETKDLYAPKPSGKASKGNKSKGKKSKSPKPVKPVEDEDEAGLQKSLKFNLMSDAPGDSPRIHLPLNYPP |
Gene Sequence | AKSGYQAGKKETKDLYAPKPSGKASKGNKSKGKKSKSPKPVKPVEDEDEAGLQKSLKFNLMSDAPGDSPRIHLPLNYPP |
Gene ID - Mouse | ENSMUSG00000051375 |
Gene ID - Rat | ENSRNOG00000060410 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PCDH1 pAb (ATL-HPA047720 w/enhanced validation) | |
Datasheet | Anti PCDH1 pAb (ATL-HPA047720 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PCDH1 pAb (ATL-HPA047720 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti PCDH1 pAb (ATL-HPA047720 w/enhanced validation) | |
Datasheet | Anti PCDH1 pAb (ATL-HPA047720 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PCDH1 pAb (ATL-HPA047720 w/enhanced validation) |