Anti PCBP4 pAb (ATL-HPA057754)

Atlas Antibodies

Catalog No.:
ATL-HPA057754-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: poly(rC) binding protein 4
Gene Name: PCBP4
Alternative Gene Name: LIP4, MCG10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023495: 96%, ENSRNOG00000012406: 96%
Entrez Gene ID: 57060
Uniprot ID: P57723
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ATIPYHPSLSLGTVLLSANQGFSVQGQYGAVTPAEVTKLQQLSSHAVPFATPSVVPGLDPGTQTSSQEFLVP
Gene Sequence ATIPYHPSLSLGTVLLSANQGFSVQGQYGAVTPAEVTKLQQLSSHAVPFATPSVVPGLDPGTQTSSQEFLVP
Gene ID - Mouse ENSMUSG00000023495
Gene ID - Rat ENSRNOG00000012406
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PCBP4 pAb (ATL-HPA057754)
Datasheet Anti PCBP4 pAb (ATL-HPA057754) Datasheet (External Link)
Vendor Page Anti PCBP4 pAb (ATL-HPA057754) at Atlas Antibodies

Documents & Links for Anti PCBP4 pAb (ATL-HPA057754)
Datasheet Anti PCBP4 pAb (ATL-HPA057754) Datasheet (External Link)
Vendor Page Anti PCBP4 pAb (ATL-HPA057754)