Anti PCBP3 pAb (ATL-HPA030247)

Atlas Antibodies

Catalog No.: ATL-HPA030247-25

Protein Description: poly(rC) binding protein 3
Gene Name: PCBP3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001120: 100%, ENSRNOG00000001245: 78%
Entrez Gene ID: 54039
Uniprot ID: P57721
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TIQGQYAIPHPDQLTKLHQLAMQQTPFPPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTIPNDLIGCIIGRQGTKINEIR
• Gene Sequence: TIQGQYAIPHPDQLTKLHQLAMQQTPFPPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTIPNDLIGCIIGRQGTKINEIR
• Gene ID - Mouse: ENSMUSG00000001120
• Gene ID - Rat: ENSRNOG00000001245
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PCBP3 pAb (ATL-HPA030247) – 2 Found

Yanatori, Izumi; Richardson, Des R; Imada, Kiyoshi; Kishi, Fumio. Iron Export through the Transporter Ferroportin 1 Is Modulated by the Iron Chaperone PCBP2. The Journal Of Biological Chemistry. 2016;291(33):17303-18. 

Yanatori, Izumi; Richardson, Des R; Toyokuni, Shinya; Kishi, Fumio. The iron chaperone poly(rC)-binding protein 2 forms a metabolon with the heme oxygenase 1/cytochrome P450 reductase complex for heme catabolism and iron transfer. The Journal Of Biological Chemistry. 2017;292(32):13205-13229.