Anti PCBD1 pAb (ATL-HPA061723)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061723-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: PCBD1
Alternative Gene Name: DCOH, PCBD, PCD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020098: 100%, ENSRNOG00000000566: 100%
Entrez Gene ID: 5092
Uniprot ID: P61457
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YNKVHITLSTHECAGLSERDINLASFIEQVAVSMT |
Gene Sequence | YNKVHITLSTHECAGLSERDINLASFIEQVAVSMT |
Gene ID - Mouse | ENSMUSG00000020098 |
Gene ID - Rat | ENSRNOG00000000566 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PCBD1 pAb (ATL-HPA061723) | |
Datasheet | Anti PCBD1 pAb (ATL-HPA061723) Datasheet (External Link) |
Vendor Page | Anti PCBD1 pAb (ATL-HPA061723) at Atlas Antibodies |
Documents & Links for Anti PCBD1 pAb (ATL-HPA061723) | |
Datasheet | Anti PCBD1 pAb (ATL-HPA061723) Datasheet (External Link) |
Vendor Page | Anti PCBD1 pAb (ATL-HPA061723) |