Anti PC pAb (ATL-HPA058765 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA058765-25
  • Immunofluorescent staining of human cell line MCF7 shows localization to mitochondria.
  • Western blot analysis in human cell lines HeLa and U-251MG using Anti-PC antibody. Corresponding PC RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: pyruvate carboxylase
Gene Name: PC
Alternative Gene Name: PCB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024892: 99%, ENSRNOG00000019372: 99%
Entrez Gene ID: 5091
Uniprot ID: P11498
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FAHFKDFTATFGPLDSLNTRLFLQGPKIAEEFEVELERGKTLHIKALAVSDLNRAGQRQVFFELNGQLRSILVKDTQAMKEMHFHPKALKDVKGQIG
Gene Sequence FAHFKDFTATFGPLDSLNTRLFLQGPKIAEEFEVELERGKTLHIKALAVSDLNRAGQRQVFFELNGQLRSILVKDTQAMKEMHFHPKALKDVKGQIG
Gene ID - Mouse ENSMUSG00000024892
Gene ID - Rat ENSRNOG00000019372
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PC pAb (ATL-HPA058765 w/enhanced validation)
Datasheet Anti PC pAb (ATL-HPA058765 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PC pAb (ATL-HPA058765 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PC pAb (ATL-HPA058765 w/enhanced validation)
Datasheet Anti PC pAb (ATL-HPA058765 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PC pAb (ATL-HPA058765 w/enhanced validation)