Anti PC pAb (ATL-HPA043922 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA043922-25

Protein Description: pyruvate carboxylase
Gene Name: PC
Alternative Gene Name: PCB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024892: 97%, ENSRNOG00000019372: 97%
Entrez Gene ID: 5091
Uniprot ID: P11498
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GADVVDVAADSMSGMTSQPSMGALVACTRGTPLDTEVPMERVFDYSEYWEGARGLYAAFDCTATMKSGNSDVYENEIPGGQYTNLHFQ
• Gene Sequence: GADVVDVAADSMSGMTSQPSMGALVACTRGTPLDTEVPMERVFDYSEYWEGARGLYAAFDCTATMKSGNSDVYENEIPGGQYTNLHFQ
• Gene ID - Mouse: ENSMUSG00000024892
• Gene ID - Rat: ENSRNOG00000019372
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PC pAb (ATL-HPA043922 w/enhanced validation) – 1 Found

Cardaci, Simone; Zheng, Liang; MacKay, Gillian; van den Broek, Niels J F; MacKenzie, Elaine D; Nixon, Colin; Stevenson, David; Tumanov, Sergey; Bulusu, Vinay; Kamphorst, Jurre J; Vazquez, Alexei; Fleming, Stewart; Schiavi, Francesca; Kalna, Gabriela; Blyth, Karen; Strathdee, Douglas; Gottlieb, Eyal. Pyruvate carboxylation enables growth of SDH-deficient cells by supporting aspartate biosynthesis. Nature Cell Biology. 2015;17(10):1317-26.