Anti PBX2 pAb (ATL-HPA061478 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061478-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: PBX2
Alternative Gene Name: G17, HOX12, PBX2MHC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034673: 86%, ENSRNOG00000000440: 86%
Entrez Gene ID: 5089
Uniprot ID: P40425
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GDSYSASQVESLRHSMGPGGYGDNLGGGQMYSPREMRANGSW |
Gene Sequence | GDSYSASQVESLRHSMGPGGYGDNLGGGQMYSPREMRANGSW |
Gene ID - Mouse | ENSMUSG00000034673 |
Gene ID - Rat | ENSRNOG00000000440 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PBX2 pAb (ATL-HPA061478 w/enhanced validation) | |
Datasheet | Anti PBX2 pAb (ATL-HPA061478 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PBX2 pAb (ATL-HPA061478 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti PBX2 pAb (ATL-HPA061478 w/enhanced validation) | |
Datasheet | Anti PBX2 pAb (ATL-HPA061478 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PBX2 pAb (ATL-HPA061478 w/enhanced validation) |
Citations for Anti PBX2 pAb (ATL-HPA061478 w/enhanced validation) – 1 Found |
Lin, Jianjiao; Zhu, Huiqiong; Hong, Linjie; Tang, Weimei; Wang, Jing; Hu, Hongsong; Wu, Xiaosheng; Chen, Yaying; Liu, Guangnan; Yang, Qiong; Li, Jiaying; Wang, Yusi; Lin, Zhizhao; Xiao, Yizhi; Dai, Weiyu; Huang, Miaojvan; Li, Guoxin; Li, Aimin; Wang, Jide; Xiang, Li; Liu, Side. Coexpression of HOXA6 and PBX2 promotes metastasis in gastric cancer. Aging. 2021;13(5):6606-6624. PubMed |