Anti PBX2 pAb (ATL-HPA061478 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA061478-100
  • Immunohistochemistry analysis in human epididymis and liver tissues using HPA061478 antibody. Corresponding PBX2 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: pre-B-cell leukemia homeobox 2
Gene Name: PBX2
Alternative Gene Name: G17, HOX12, PBX2MHC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034673: 86%, ENSRNOG00000000440: 86%
Entrez Gene ID: 5089
Uniprot ID: P40425
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GDSYSASQVESLRHSMGPGGYGDNLGGGQMYSPREMRANGSW
Gene Sequence GDSYSASQVESLRHSMGPGGYGDNLGGGQMYSPREMRANGSW
Gene ID - Mouse ENSMUSG00000034673
Gene ID - Rat ENSRNOG00000000440
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PBX2 pAb (ATL-HPA061478 w/enhanced validation)
Datasheet Anti PBX2 pAb (ATL-HPA061478 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PBX2 pAb (ATL-HPA061478 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PBX2 pAb (ATL-HPA061478 w/enhanced validation)
Datasheet Anti PBX2 pAb (ATL-HPA061478 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PBX2 pAb (ATL-HPA061478 w/enhanced validation)



Citations for Anti PBX2 pAb (ATL-HPA061478 w/enhanced validation) – 1 Found
Lin, Jianjiao; Zhu, Huiqiong; Hong, Linjie; Tang, Weimei; Wang, Jing; Hu, Hongsong; Wu, Xiaosheng; Chen, Yaying; Liu, Guangnan; Yang, Qiong; Li, Jiaying; Wang, Yusi; Lin, Zhizhao; Xiao, Yizhi; Dai, Weiyu; Huang, Miaojvan; Li, Guoxin; Li, Aimin; Wang, Jide; Xiang, Li; Liu, Side. Coexpression of HOXA6 and PBX2 promotes metastasis in gastric cancer. Aging. 2021;13(5):6606-6624.  PubMed