Anti PBRM1 pAb (ATL-HPA015629 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA015629-25

Protein Description: polybromo 1
Gene Name: PBRM1
Alternative Gene Name: BAF180, PB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042323: 97%, ENSRNOG00000028227: 96%
Entrez Gene ID: 55193
Uniprot ID: Q86U86
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KMEEYDDVNLLTADFQLLFNNAKSYYKPDSPEYKAACKLWDLYLRTRNEFVQKGEADDEDDDEDGQDNQGTVTEGSSPAYLKEILEQLLEAIVVATNPSGRLISELFQKLPSKVQYPDYYAIIKEPIDLKTIAQRIQNGSYKSIHA
• Gene Sequence: KMEEYDDVNLLTADFQLLFNNAKSYYKPDSPEYKAACKLWDLYLRTRNEFVQKGEADDEDDDEDGQDNQGTVTEGSSPAYLKEILEQLLEAIVVATNPSGRLISELFQKLPSKVQYPDYYAIIKEPIDLKTIAQRIQNGSYKSIHA
• Gene ID - Mouse: ENSMUSG00000042323
• Gene ID - Rat: ENSRNOG00000028227
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PBRM1 pAb (ATL-HPA015629 w/enhanced validation) – 2 Found

Wu, Junlong; Xu, Wen-Hao; Wei, Yu; Qu, Yuan-Yuan; Zhang, Hai-Liang; Ye, Ding-Wei. An Integrated Score and Nomogram Combining Clinical and Immunohistochemistry Factors to Predict High ISUP Grade Clear Cell Renal Cell Carcinoma. Frontiers In Oncology. 8( 30619768):634. 

Ma, Bingqi; Meng, Huijuan; Tian, Ye; Wang, Yingying; Song, Tianqiang; Zhang, Ti; Wu, Qiang; Cui, Yunlong; Li, Huikai; Zhang, Wei; Li, Qiang. Distinct clinical and prognostic implication of IDH1/2 mutation and other most frequent mutations in large duct and small duct subtypes of intrahepatic cholangiocarcinoma. Bmc Cancer. 2020;20(1):318.