Anti PBRM1 pAb (ATL-HPA015629 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA015629-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PBRM1
Alternative Gene Name: BAF180, PB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042323: 97%, ENSRNOG00000028227: 96%
Entrez Gene ID: 55193
Uniprot ID: Q86U86
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KMEEYDDVNLLTADFQLLFNNAKSYYKPDSPEYKAACKLWDLYLRTRNEFVQKGEADDEDDDEDGQDNQGTVTEGSSPAYLKEILEQLLEAIVVATNPSGRLISELFQKLPSKVQYPDYYAIIKEPIDLKTIAQRIQNGSYKSIHA |
| Gene Sequence | KMEEYDDVNLLTADFQLLFNNAKSYYKPDSPEYKAACKLWDLYLRTRNEFVQKGEADDEDDDEDGQDNQGTVTEGSSPAYLKEILEQLLEAIVVATNPSGRLISELFQKLPSKVQYPDYYAIIKEPIDLKTIAQRIQNGSYKSIHA |
| Gene ID - Mouse | ENSMUSG00000042323 |
| Gene ID - Rat | ENSRNOG00000028227 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PBRM1 pAb (ATL-HPA015629 w/enhanced validation) | |
| Datasheet | Anti PBRM1 pAb (ATL-HPA015629 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PBRM1 pAb (ATL-HPA015629 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti PBRM1 pAb (ATL-HPA015629 w/enhanced validation) | |
| Datasheet | Anti PBRM1 pAb (ATL-HPA015629 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PBRM1 pAb (ATL-HPA015629 w/enhanced validation) |
| Citations for Anti PBRM1 pAb (ATL-HPA015629 w/enhanced validation) – 2 Found |
| Wu, Junlong; Xu, Wen-Hao; Wei, Yu; Qu, Yuan-Yuan; Zhang, Hai-Liang; Ye, Ding-Wei. An Integrated Score and Nomogram Combining Clinical and Immunohistochemistry Factors to Predict High ISUP Grade Clear Cell Renal Cell Carcinoma. Frontiers In Oncology. 8( 30619768):634. PubMed |
| Ma, Bingqi; Meng, Huijuan; Tian, Ye; Wang, Yingying; Song, Tianqiang; Zhang, Ti; Wu, Qiang; Cui, Yunlong; Li, Huikai; Zhang, Wei; Li, Qiang. Distinct clinical and prognostic implication of IDH1/2 mutation and other most frequent mutations in large duct and small duct subtypes of intrahepatic cholangiocarcinoma. Bmc Cancer. 2020;20(1):318. PubMed |