Anti PBOV1 pAb (ATL-HPA063021)

Atlas Antibodies

SKU: ATL-HPA063021-25

• 

Protein Description: prostate and breast cancer overexpressed 1
Gene Name: PBOV1
Alternative Gene Name: UC28, UROC28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036097: 25%, ENSRNOG00000016146: 23%
Entrez Gene ID: 59351
Uniprot ID: Q9GZY1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MRAFLRNQKYEDMHNIIHILQIRKLRHRLSNFPRLPGILAPETVLLPFCYKVFRKKEKVKRSQKATEFIDY
• Gene Sequence: MRAFLRNQKYEDMHNIIHILQIRKLRHRLSNFPRLPGILAPETVLLPFCYKVFRKKEKVKRSQKATEFIDY
• Gene ID - Mouse: ENSMUSG00000036097
• Gene ID - Rat: ENSRNOG00000016146
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.