Anti PBOV1 pAb (ATL-HPA063021)

Atlas Antibodies

Catalog No.:
ATL-HPA063021-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: prostate and breast cancer overexpressed 1
Gene Name: PBOV1
Alternative Gene Name: UC28, UROC28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036097: 25%, ENSRNOG00000016146: 23%
Entrez Gene ID: 59351
Uniprot ID: Q9GZY1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MRAFLRNQKYEDMHNIIHILQIRKLRHRLSNFPRLPGILAPETVLLPFCYKVFRKKEKVKRSQKATEFIDY
Gene Sequence MRAFLRNQKYEDMHNIIHILQIRKLRHRLSNFPRLPGILAPETVLLPFCYKVFRKKEKVKRSQKATEFIDY
Gene ID - Mouse ENSMUSG00000036097
Gene ID - Rat ENSRNOG00000016146
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PBOV1 pAb (ATL-HPA063021)
Datasheet Anti PBOV1 pAb (ATL-HPA063021) Datasheet (External Link)
Vendor Page Anti PBOV1 pAb (ATL-HPA063021) at Atlas Antibodies

Documents & Links for Anti PBOV1 pAb (ATL-HPA063021)
Datasheet Anti PBOV1 pAb (ATL-HPA063021) Datasheet (External Link)
Vendor Page Anti PBOV1 pAb (ATL-HPA063021)