Anti PBOV1 pAb (ATL-HPA063021)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063021-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PBOV1
Alternative Gene Name: UC28, UROC28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036097: 25%, ENSRNOG00000016146: 23%
Entrez Gene ID: 59351
Uniprot ID: Q9GZY1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MRAFLRNQKYEDMHNIIHILQIRKLRHRLSNFPRLPGILAPETVLLPFCYKVFRKKEKVKRSQKATEFIDY |
Gene Sequence | MRAFLRNQKYEDMHNIIHILQIRKLRHRLSNFPRLPGILAPETVLLPFCYKVFRKKEKVKRSQKATEFIDY |
Gene ID - Mouse | ENSMUSG00000036097 |
Gene ID - Rat | ENSRNOG00000016146 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PBOV1 pAb (ATL-HPA063021) | |
Datasheet | Anti PBOV1 pAb (ATL-HPA063021) Datasheet (External Link) |
Vendor Page | Anti PBOV1 pAb (ATL-HPA063021) at Atlas Antibodies |
Documents & Links for Anti PBOV1 pAb (ATL-HPA063021) | |
Datasheet | Anti PBOV1 pAb (ATL-HPA063021) Datasheet (External Link) |
Vendor Page | Anti PBOV1 pAb (ATL-HPA063021) |