Anti PAX8 pAb (ATL-HPA064554)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064554-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: PAX8
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026976: 90%, ENSRNOG00000026203: 88%
Entrez Gene ID: 7849
Uniprot ID: Q06710
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGY |
| Gene Sequence | SLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGY |
| Gene ID - Mouse | ENSMUSG00000026976 |
| Gene ID - Rat | ENSRNOG00000026203 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PAX8 pAb (ATL-HPA064554) | |
| Datasheet | Anti PAX8 pAb (ATL-HPA064554) Datasheet (External Link) |
| Vendor Page | Anti PAX8 pAb (ATL-HPA064554) at Atlas Antibodies |
| Documents & Links for Anti PAX8 pAb (ATL-HPA064554) | |
| Datasheet | Anti PAX8 pAb (ATL-HPA064554) Datasheet (External Link) |
| Vendor Page | Anti PAX8 pAb (ATL-HPA064554) |