Anti PAX5 pAb (ATL-HPA056394 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA056394-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: paired box 5
Gene Name: PAX5
Alternative Gene Name: BSAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014030: 100%, ENSRNOG00000024729: 100%
Entrez Gene ID: 5079
Uniprot ID: Q02548
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQL
Gene Sequence SGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQL
Gene ID - Mouse ENSMUSG00000014030
Gene ID - Rat ENSRNOG00000024729
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PAX5 pAb (ATL-HPA056394 w/enhanced validation)
Datasheet Anti PAX5 pAb (ATL-HPA056394 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PAX5 pAb (ATL-HPA056394 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PAX5 pAb (ATL-HPA056394 w/enhanced validation)
Datasheet Anti PAX5 pAb (ATL-HPA056394 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PAX5 pAb (ATL-HPA056394 w/enhanced validation)
Citations for Anti PAX5 pAb (ATL-HPA056394 w/enhanced validation) – 2 Found
Xu, Sunwang; Jiang, Cen; Lin, Ruirong; Wang, Xiaopeng; Hu, Xiaoqiang; Chen, Wei; Chen, Xiangjin; Chen, Tao. Epigenetic activation of the elongator complex sensitizes gallbladder cancer to gemcitabine therapy. Journal Of Experimental & Clinical Cancer Research : Cr. 2021;40(1):373.  PubMed
Kaiser, Fabian M P; Gruenbacher, Sarah; Oyaga, Maria Roa; Nio, Enzo; Jaritz, Markus; Sun, Qiong; van der Zwaag, Wietske; Kreidl, Emanuel; Zopf, Lydia M; Dalm, Virgil A S H; Pel, Johan; Gaiser, Carolin; van der Vliet, Rick; Wahl, Lucas; Rietman, André; Hill, Louisa; Leca, Ines; Driessen, Gertjan; Laffeber, Charlie; Brooks, Alice; Katsikis, Peter D; Lebbink, Joyce H G; Tachibana, Kikuë; van der Burg, Mirjam; De Zeeuw, Chris I; Badura, Aleksandra; Busslinger, Meinrad. Biallelic PAX5 mutations cause hypogammaglobulinemia, sensorimotor deficits, and autism spectrum disorder. The Journal Of Experimental Medicine. 2022;219(9)  PubMed