Anti PAX5 pAb (ATL-HPA056394 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056394-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: PAX5
Alternative Gene Name: BSAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014030: 100%, ENSRNOG00000024729: 100%
Entrez Gene ID: 5079
Uniprot ID: Q02548
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQL |
| Gene Sequence | SGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQL |
| Gene ID - Mouse | ENSMUSG00000014030 |
| Gene ID - Rat | ENSRNOG00000024729 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PAX5 pAb (ATL-HPA056394 w/enhanced validation) | |
| Datasheet | Anti PAX5 pAb (ATL-HPA056394 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PAX5 pAb (ATL-HPA056394 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti PAX5 pAb (ATL-HPA056394 w/enhanced validation) | |
| Datasheet | Anti PAX5 pAb (ATL-HPA056394 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PAX5 pAb (ATL-HPA056394 w/enhanced validation) |
| Citations for Anti PAX5 pAb (ATL-HPA056394 w/enhanced validation) – 2 Found |
| Xu, Sunwang; Jiang, Cen; Lin, Ruirong; Wang, Xiaopeng; Hu, Xiaoqiang; Chen, Wei; Chen, Xiangjin; Chen, Tao. Epigenetic activation of the elongator complex sensitizes gallbladder cancer to gemcitabine therapy. Journal Of Experimental & Clinical Cancer Research : Cr. 2021;40(1):373. PubMed |
| Kaiser, Fabian M P; Gruenbacher, Sarah; Oyaga, Maria Roa; Nio, Enzo; Jaritz, Markus; Sun, Qiong; van der Zwaag, Wietske; Kreidl, Emanuel; Zopf, Lydia M; Dalm, Virgil A S H; Pel, Johan; Gaiser, Carolin; van der Vliet, Rick; Wahl, Lucas; Rietman, André; Hill, Louisa; Leca, Ines; Driessen, Gertjan; Laffeber, Charlie; Brooks, Alice; Katsikis, Peter D; Lebbink, Joyce H G; Tachibana, Kikuë; van der Burg, Mirjam; De Zeeuw, Chris I; Badura, Aleksandra; Busslinger, Meinrad. Biallelic PAX5 mutations cause hypogammaglobulinemia, sensorimotor deficits, and autism spectrum disorder. The Journal Of Experimental Medicine. 2022;219(9) PubMed |