Anti PAX3 pAb (ATL-HPA063659)

Atlas Antibodies

Catalog No.:
ATL-HPA063659-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: paired box 3
Gene Name: PAX3
Alternative Gene Name: HUP2, WS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004872: 92%, ENSRNOG00000013670: 92%
Entrez Gene ID: 5077
Uniprot ID: P23760
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PHQPQTDYALSPLTGGLEPTTTVSASCSQRLDHMKSL
Gene Sequence PHQPQTDYALSPLTGGLEPTTTVSASCSQRLDHMKSL
Gene ID - Mouse ENSMUSG00000004872
Gene ID - Rat ENSRNOG00000013670
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PAX3 pAb (ATL-HPA063659)
Datasheet Anti PAX3 pAb (ATL-HPA063659) Datasheet (External Link)
Vendor Page Anti PAX3 pAb (ATL-HPA063659) at Atlas Antibodies

Documents & Links for Anti PAX3 pAb (ATL-HPA063659)
Datasheet Anti PAX3 pAb (ATL-HPA063659) Datasheet (External Link)
Vendor Page Anti PAX3 pAb (ATL-HPA063659)
Citations for Anti PAX3 pAb (ATL-HPA063659) – 1 Found
Liu, Li-Ping; Guo, Ning-Ning; Li, Yu-Mei; Zheng, Yun-Wen. Generation of Human iMelanocytes from Induced Pluripotent Stem Cells through a Suspension Culture System. Star Protocols. 2020;1(1):100004.  PubMed