Anti PAX2 pAb (ATL-HPA070751)
Atlas Antibodies
- SKU:
- ATL-HPA070751-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: PAX2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004231: 100%, ENSRNOG00000014253: 100%
Entrez Gene ID: 5076
Uniprot ID: Q02962
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TKVQQPFHPTPDGAGTGVTAPGHTIVPSTAS |
Gene Sequence | TKVQQPFHPTPDGAGTGVTAPGHTIVPSTAS |
Gene ID - Mouse | ENSMUSG00000004231 |
Gene ID - Rat | ENSRNOG00000014253 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PAX2 pAb (ATL-HPA070751) | |
Datasheet | Anti PAX2 pAb (ATL-HPA070751) Datasheet (External Link) |
Vendor Page | Anti PAX2 pAb (ATL-HPA070751) at Atlas Antibodies |
Documents & Links for Anti PAX2 pAb (ATL-HPA070751) | |
Datasheet | Anti PAX2 pAb (ATL-HPA070751) Datasheet (External Link) |
Vendor Page | Anti PAX2 pAb (ATL-HPA070751) |